DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and Kdm4dl2

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_008764220.1 Gene:Kdm4dl2 / 500944 RGDID:1563367 Length:460 Species:Rattus norvegicus


Alignment Length:478 Identity:217/478 - (45%)
Similarity:282/478 - (58%) Gaps:80/478 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DEEQNKVPRIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPRKSGYDIDNINMTI 73
            |..||....||||.|:.|||.:|..||.|:||:|||.||:||:.||.:|..|:|..|:  ::|:|
  Rat     7 DVSQNPGCSIMTFCPTMEEFSDFCKYIAYMESQGAHRAGVAKVIPPKDWKRRQSYEDV--MDMSI 69

  Fly    74 PAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFDYDDLERKYWKNITYISPL 138
            |||:.|||:|..||:.|.: ::::.||:.::.|.|.|:.:|||.|.|::|||||||||..:.||:
  Rat    70 PAPLQQVVSGKAGVFTQYH-KKKKAMTVGKYRELAESKQYQTPPHLDFEDLERKYWKNRLFGSPI 133

  Fly   139 YAADVKGSLSDEDLDVWNIGRLDTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWHTEDMDLYS 203
            |.|||.|||.||:...||:|.|.::|:::..|..|:|:||||.||||||||:|||||||||||||
  Rat   134 YGADVSGSLFDENTQHWNVGHLGSLLDVLKQDRGIVIEGVNTPYLYFGMWKTSFAWHTEDMDLYS 198

  Fly   204 INYLHFGAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKIT 268
            |||||||.||||||:||.:|||||.||.|.|..:.|.|.|:||||:.:|||.||:::.||:.:||
  Rat   199 INYLHFGQPKTWYAVPPEHGRRLELLAKELFPGSSQGCQAFLRHKVALISPTVLKENGIPFGRIT 263

  Fly   269 QEAGEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRASICRCRSDMVKISMETFVRRFQP 333
            |||||.|:|||:|||||||||||.||:.|||:.|||:|||.||.|.|....|..||:.|....||
  Rat   264 QEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDYGKVASQCSCGEARVSFSMDAFEGLLQP 328

  Fly   334 ERYD----------------------------------------------NWLKGQDMGC----- 347
            |.|:                                              |||:.....|     
  Rat   329 EPYEMWKQQGNQRAMDPLALTSGPRQELTLGIDQLKPDSKQNGSHSGPRRNWLRRGQKSCPYRKV 393

  Fly   348 HPEEPGKICAAAPPTLNEYEKQENLRAAKSEEESPQKRGCSLAGNGCERNAESAEDVDDKASVSS 412
            |.|.|      .|||       ..|.|.:|   .||...||...:|..:......||   .:|:.
  Rat   394 HAESP------CPPT-------GKLLAPRS---VPQGTRCSKQASGSSKTPAICADV---LAVNH 439

  Fly   413 YSSCRQLQPVVKLRKLPTIASVP 435
            ..:||.|.     |.|  |.|:|
  Rat   440 SQACRILD-----RSL--IVSLP 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 24/41 (59%)
JmjC 182..298 CDD:202224 83/115 (72%)
Kdm4dl2XP_008764220.1 JmjN 16..56 CDD:128818 23/39 (59%)
JmjC 177..293 CDD:396791 83/115 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1186832at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.