DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kdm4A and Phf14

DIOPT Version :9

Sequence 1:	NP_610331.1	Gene:	Kdm4A / 35744	FlyBaseID:	FBgn0033233	Length:	495	Species:	Drosophila melanogaster
Sequence 2:	XP_006236166.1	Gene:	Phf14 / 500030	RGDID:	1563764	Length:	950	Species:	Rattus norvegicus

Alignment Length:	136	Identity:	33/136 - (24%)
Similarity:	51/136 - (37%)	Gaps:	46/136 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   350 EEPGK-----ICAAAPPTLNEYE-------KQENLRAA----------------KSEEES---PQ 383
            |:|.|     .|:.:...:.|.|       |:|.||.:                |.|||:   |:
  Rat    47 EDPSKDSGEGSCSDSEENILEEELNEDIKVKEEQLRNSTEEIMSSDKQLIKMEKKEEEENGERPR 111

  Fly   384 KRGCSLAGNGCERNAESAEDVD-DKASVSSYSSCRQL-------QPVVKLRKLP-TIASVPEPSS 439
            ||      ...|:..|...:.| :||:||..::....       .|.|....:| |..|..|..|
  Rat   112 KR------KEKEKEKEKEREKDKEKATVSDSAAASAAGTTPATSPPAVTSPAVPTTTTSSEEQVS 170

  Fly   440 APKRYD 445
            .||:::
  Rat   171 EPKKWN 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
Kdm4A	NP_610331.1	JmjN	17..59	CDD:301729
Kdm4A	NP_610331.1	JmjC	182..298	CDD:202224
Phf14	XP_006236166.1	PHD1_PHF14	313..369	CDD:277036
		ePHD_PHF14	377..490	CDD:277144
		PHD2_PHF14	719..768	CDD:277037
		PHD3_PHF14	862..920	CDD:277038
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5141
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900