DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and lid

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001245908.1 Gene:lid / 33837 FlyBaseID:FBgn0031759 Length:1838 Species:Drosophila melanogaster


Alignment Length:441 Identity:120/441 - (27%)
Similarity:190/441 - (43%) Gaps:101/441 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PPAEWVPRKSGYDIDNINMTIPAPICQVVTGAHGVYQQINIQQ-RRQMTLRQFMEKAN---SELH 113
            |..||:                .|.| ||.......:....:| .|:.||:||.:.|:   .|..
  Fly   486 PKGEWL----------------CPRC-VVEEVSKPQEAFGFEQAEREYTLQQFGQMADQFKQEYF 533

  Fly   114 QTPRHF-DYDDLERKYWKNITYI----SPLYAADV-----------KGSL----SDEDL--DVWN 156
            :.|.|. ..:.:||::|:.::.|    :..|.||:           |.||    .|::.  ..||
  Fly   534 RKPVHLVPTEMVEREFWRIVSSIDEDVTVEYGADLHTMDHGSGFPTKSSLYLLPGDQEYAESSWN 598

  Fly   157 IGRL----DTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWHTEDMDLYSINYLHFGAPKTWYA 217
            :..|    |:||..:|.|    |.|:|..::|.||..::|.||.||...|||||||:|.|||||.
  Fly   599 LNNLPLLEDSILGHINAD----ISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYG 659

  Fly   218 IPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKITQEAGEIMITFPFGY 282
            :|.:...:.|:...:...|.:......|...:|:::|.:|..:.:|..:..|.|||.:||||..|
  Fly   660 VPGSCAEQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAY 724

  Fly   283 HAGFNHGFNGAESTNFASKRWIEYGKRASICRCRSDMVKISMETFVRRFQPERYDNWLKGQDMGC 347
            |||||.|:|.||:.|||...|::.|:..           ::..:.:|||....:|      ::.|
  Fly   725 HAGFNQGYNFAEAVNFAPADWLKMGREC-----------VNHYSMLRRFCVFSHD------ELVC 772

  Fly   348 HPE-EPGKI-------CAAAPPTLNEYEK--QENL------RAAKSEEE--SPQKRGCSLAGNGC 394
            ... ||.|:       |......:.:.||  :::|      ||.:...|  :..:|.|......|
  Fly   773 KMALEPAKLTFGIATACYIDMAEMVDTEKKLRKSLLEWGVTRAERRAFELVNDDERHCQECNTTC 837

  Fly   395 ERNAESAEDVDDKASVSSYSSCRQLQPVVKLRKLPTIAS-VPEPSSAPKRY 444
            ..:|.:.| .:||.             :|.||....:.. .||..:...||
  Fly   838 FLSAVACE-CNDKL-------------IVCLRHYTVLCGCAPEKHTLIYRY 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 3/5 (60%)
JmjC 182..298 CDD:202224 47/115 (41%)
lidNP_001245908.1 JmjN 160..201 CDD:128818
ARID 227..312 CDD:198082
PHD1_Lid_like 450..495 CDD:277078 4/24 (17%)
JmjC 624..740 CDD:202224 47/115 (41%)
zf-C5HC2 830..882 CDD:280996 13/59 (22%)
PLU-1 896..1229 CDD:285609
PHD2_KDM5A 1295..1351 CDD:277079
PHD3_KDM5A_like 1755..1805 CDD:277083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10694
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.