DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and CG15439

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_608836.1 Gene:CG15439 / 33651 FlyBaseID:FBgn0031606 Length:1008 Species:Drosophila melanogaster


Alignment Length:537 Identity:100/537 - (18%)
Similarity:164/537 - (30%) Gaps:187/537 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSSFADEEQNKVPRIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPRKSGYDIDN 68
            :.:.|.|.:...|..   .|:....|.....|::..:|...|       .|..|||.:....:  
  Fly   324 KEALAAEHETPAPHP---NPAQARIQRKLLKIQHKYTRHKEL-------KPTPWVPTQKMSRL-- 376

  Fly    69 INMTIPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFDYDDLERKYWKNIT 133
              :|..|..|                 ||.:...:.|......|.|...|.:.....||.|    
  Fly   377 --LTTSASAC-----------------RRLLAKAEIMSVDVQHLEQREAHINALTDIRKKW---- 418

  Fly   134 YISPLYAADVKGSLSDEDLDVWNIGRLDTILN----------LVNTDYNIIIDGVNTAYLYFGMW 188
            :|:|.::.:......|      .|.|:|....          :::.|.:::....:||     :.
  Fly   419 HIAPAFSVEFTAYYMD------RIVRMDDFRQQQRELISHNAILSKDQDVLRAQYDTA-----LE 472

  Fly   189 KSSFAWHTEDMDLYSINYLHFGAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMIS 253
            :......|:|..|.||..||           .|.|:....:...:..        .:.|.:....
  Fly   473 ERKAVKATKDSLLTSIKSLH-----------TALGQIAPNMTLPSVD--------LIAHPLPEAP 518

  Fly   254 PKV------LRQHNIPYNKITQEAGEIMITFPFGYHAG------------FNHGFNGAESTNFAS 300
            ||.      .|..::|    |..|.::.:.||.| |.|            ..|...|..||:.||
  Fly   519 PKTSTPTPPQRPISVP----TAAALKMGVGFPLG-HLGPPGSKMDSSRMLSTHAKQGKHSTSSAS 578

  Fly   301 KRWIEYGKRAS--IC-RCRSDMVKISMETFVRRFQPERYDNWLKGQDMGCHPEEPGKICAAAPPT 362
               :|.....|  || |.:...:.:..:|....:.            :||           ..|.
  Fly   579 ---VEAAPSVSCGICKRSKDQHLLVKCDTCNLHYH------------LGC-----------LNPP 617

  Fly   363 LNEYEKQENLRAAKSEEESPQKRGCSLAGNGCERNAESAEDVDDKAS-----------------V 410
            |....|       ||::...|...|      |:: :|.::.|.:.:|                 |
  Fly   618 LTRPPK-------KSKQYGWQCSEC------CDK-SEGSDAVTEISSGPRKSRTRFNKDGHLVYV 668

  Fly   411 SSYSSCRQLQPVVKLRKLPTIA-SVPEPSSAPKRYDFNTEAVVRVKRLWNE-LPCPDRGANLLTN 473
            ..||          |..:|..| :||:.|              ..||..|: ||.|   |.....
  Fly   669 DRYS----------LDDIPVAAVNVPKES--------------HTKRALNKSLPAP---APEYIE 706

  Fly   474 GVVKNTKRMRFQTKVLT 490
            .:.|:.||.:.|:...|
  Fly   707 DLTKSPKRPKLQSPCKT 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 7/41 (17%)
JmjC 182..298 CDD:202224 25/133 (19%)
CG15439NP_608836.1 PHD1_PHF14 120..175 CDD:277036
ePHD_PHF14 184..297 CDD:277144
PHD2_PHF14 586..635 CDD:277037 13/78 (17%)
PHD3_PHF14 949..997 CDD:277038
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.