DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and jade1

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_956099.1 Gene:jade1 / 327437 ZFINID:ZDB-GENE-030131-5648 Length:829 Species:Danio rerio


Alignment Length:294 Identity:44/294 - (14%)
Similarity:86/294 - (29%) Gaps:131/294 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LEKLANETFSENYQECNAYLRHKMTMI---------SPKVLRQHNIPYNKITQEAGEIMITF--- 278
            ||::.|.|:..:.:|     |.|.|:.         ..::|.|..:.....|:...|.|..|   
Zfish   496 LERVRNLTYMVSRRE-----RIKRTLCRVQEQIFHHHVRLLEQGRVTGVSSTRRLEEAMFYFRTT 555

  Fly   279 --------PFGYHAGFNHGFNGAE--STNFASKRWIEYGKRASICRCRSDMVKISMETFVRRFQP 333
                    |...|.|.|...:.:|  |.::.|.:.||                            
Zfish   556 PPVPASPQPLKGHCGQNSTLSSSEKGSNSYRSSKHIE---------------------------- 592

  Fly   334 ERYDNWLKGQDMGCHPEEPGKICAAAPPTLNEYEKQENLRAAKSEEESPQKRGCSLAGNGCERNA 398
                           .::|.|:.....|:..:..:.|.:.:|.|.    :..|.:.:|....:..
Zfish   593 ---------------ADKPAKMLMDGVPSSGDSVRSETVMSASSR----RSEGRTRSGESHRKEE 638

  Fly   399 ESAEDVDDKASVSSYSSCRQLQPVVKLRKLPTIASVPEPSSAPKRYDFNTEAVVRVKRLWNELPC 463
            ||...::|:.                                            |..:||:::..
Zfish   639 ESERPLEDRR--------------------------------------------RKSKLWDQVSI 659

  Fly   464 PDRGANLLTNGVVKNTKRMR----FQTKVLTLDD 493
            .|:         :::.|.|.    .:|::.|:||
Zfish   660 KDK---------LRHAKSMEDTLSSETELDTMDD 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 20/93 (22%)
jade1NP_956099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
EPL1 <104..173 CDD:287484
PHD_JADE1 198..243 CDD:277149
ePHD_JADE 251..361 CDD:277141
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..408
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..651 21/185 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.