DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kdm4A and jade3

DIOPT Version :9

Sequence 1:	NP_610331.1	Gene:	Kdm4A / 35744	FlyBaseID:	FBgn0033233	Length:	495	Species:	Drosophila melanogaster
Sequence 2:	NP_970614.2	Gene:	jade3 / 322209	ZFINID:	ZDB-GENE-030131-928	Length:	795	Species:	Danio rerio

Alignment Length:	125	Identity:	27/125 - (21%)
Similarity:	49/125 - (39%)	Gaps:	38/125 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 RIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPRKSGYDIDNINMTIPAPICQVV 81
            ||:|.:|....|.....||: ..|:.:...|...|:..||.:.|   ||:|::::
Zfish    96 RIITEKPKEVLFSKPRKYIQ-CWSQDSTETGYVNIKELAEAMCR---YDLDDMDL---------- 146

  Fly    82 TGAHGVY--QQINIQQRR-------QMTLRQFMEKANSELHQTPRH---------FDYDD 123
                  |  ||:|.:...       ::|:.:.||....:.|:...|         .:||:
Zfish   147 ------YWLQQLNAELGMMGDGVVDELTMERVMEALERQCHENMNHAIETEEGLGIEYDE 200

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kdm4A	NP_610331.1	JmjN	17..59	CDD:301729	12/41 (29%)
Kdm4A	NP_610331.1	JmjC	182..298	CDD:202224
jade3	NP_970614.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..41
		EPL1	<89..178	CDD:287484	23/101 (23%)
		COG5141	139..555	CDD:227470	14/78 (18%)
		PHD_JADE3	203..252	CDD:277151
		ePHD_JADE3	256..366	CDD:277176
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	630..654
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	667..687
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	714..795
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5141
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900