DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and Jade1

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_006232363.1 Gene:Jade1 / 310352 RGDID:1306920 Length:847 Species:Rattus norvegicus


Alignment Length:303 Identity:56/303 - (18%)
Similarity:95/303 - (31%) Gaps:112/303 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 DLYSINYLHFGAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPY 264
            |.|.:|      |..:|.:...:.:..||                  .....:||..:.|   |.
  Rat    75 DSYQLN------PDEYYVLADPWRQEWEK------------------GVQVPVSPGTIPQ---PV 112

  Fly   265 NKITQEAGEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRA-SICRC-RSDM----VKIS 323
            .::..|...:|...|..|.|.     :|:|.....   :::....| |:||. .:||    ::::
  Rat   113 ARVVSEEKSLMFIRPKKYIAS-----SGSEPPELG---YVDIRTLADSVCRYDLNDMDAAWLELT 169

  Fly   324 METFVRRFQPERYDNWLKGQDMGCHPEEPGKICAAAPPTLNEYEKQ--ENLRAAKSEEESPQKRG 386
            .|.|.....|| .|.:...:                  .|.|:|::  :|:..|...||      
  Rat   170 NEEFKEMGMPE-LDEYTMER------------------VLEEFEQRCYDNMNHAIETEE------ 209

  Fly   387 CSLAGNGCERNAESAEDV--------------DDKASVSSYSSCRQLQPVVKLRKLPTIASVPEP 437
                |.|.|.:.:...||              .||.::..:.:|.            .|..|||.
  Rat   210 ----GLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACY------------GILKVPEG 258

  Fly   438 SSAPKRYDFNTEAVVRVKRLWNELPCPDRGANLLTNGVVKNTK 480
            |...:......:...        |.||.:|      |.:|.|:
  Rat   259 SWLCRTCALGVQPKC--------LLCPKKG------GAMKPTR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 18/97 (19%)
Jade1XP_006232363.1 EPL1 <107..195 CDD:287484 22/117 (19%)
PHD_JADE1 220..265 CDD:277149 10/56 (18%)
ePHD_JADE1 270..387 CDD:277174 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.