DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and Brpf3

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_006256191.1 Gene:Brpf3 / 309647 RGDID:1306868 Length:1328 Species:Rattus norvegicus


Alignment Length:93 Identity:23/93 - (24%)
Similarity:43/93 - (46%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 EPGKICAAAPPTLNE----YEKQENLRAAKSE-EESPQKRGCSLAGNGCERNAESAEDVDDKASV 410
            |.|:...|:|.::.|    .::..:...:.|| |.|||:...:...||..::.||..|.:....:
  Rat  1077 ENGEDAPASPASMEEEHCSRKRPRSQSCSDSEGERSPQQEEETGVTNGFGKHTESGSDSECSLGL 1141

  Fly   411 S---SYSSCRQLQPVVKLRKLPTIASVP 435
            |   ::.:...|.|..:.|..|.::.||
  Rat  1142 SGGLAFEAGSGLTPPKRSRGKPALSRVP 1169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224
Brpf3XP_006256191.1 EPL1 177..323 CDD:287484
PHD_BRPF 341..394 CDD:277047
ePHD_BRPF3 398..515 CDD:277173
Bromo_brd1_like 721..818 CDD:99944
DUF2890 909..>1004 CDD:287991
BR140_related 1197..1312 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.