DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and BRPF3

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_056510.2 Gene:BRPF3 / 27154 HGNCID:14256 Length:1205 Species:Homo sapiens


Alignment Length:176 Identity:43/176 - (24%)
Similarity:72/176 - (40%) Gaps:42/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 GKRASIC-RCRSDMVKISMETFVRRFQPER-YDNWLKGQDMGC--HPEEPGKICAAAPPTLNEYE 367
            |:|.|:. :...:.||:..       .|:| .:|   |:|.|.  .|..|..|         |.|
Human   924 GRRTSVLFKKAKNGVKLQR-------SPDRVLEN---GEDHGVAGSPASPASI---------EEE 969

  Fly   368 KQENLR-----AAKSE-EESPQKRGCSLAGNGCERNAESAEDVDDKASVS---SYSSCRQLQPVV 423
            :....|     .::|| |.|||:...:...||..::.||..|.:....:|   ::.:|..|.|..
Human   970 RHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSGGLAFEACSGLTPPK 1034

  Fly   424 KLRKLPTIASVP--EPSSAPKRYDFNTEAVVRVKRLWNELPCPDRG 467
            :.|..|.::.||  |..:....|:.:..:::        ||..|||
Human  1035 RSRGKPALSRVPFLEGVNGDSDYNGSGRSLL--------LPFEDRG 1072

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224
BRPF3NP_056510.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
EPL1 48..194 CDD:287484
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..121
PHD_BRPF 212..265 CDD:277047
ePHD_BRPF3 269..386 CDD:277173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..472
Bromo_brd1_like 593..690 CDD:99944
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 779..897
DUF4628 <848..972 CDD:292069 16/66 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 907..926 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 931..1015 25/102 (25%)
BR140_related 1074..1189 CDD:99900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.