DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and jmj2

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_593492.1 Gene:jmj2 / 2543275 PomBaseID:SPAC1002.05c Length:715 Species:Schizosaccharomyces pombe


Alignment Length:228 Identity:73/228 - (32%)
Similarity:110/228 - (48%) Gaps:38/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FMEKANSELHQTPRHFDYDDLERKYWK----NITYISPLYAADV-------------KGSLSDED 151
            |.:..:||:.:       |.:|::|||    |.|.:...|.||:             |..::...
pombe   367 FSKFKDSEITE-------DIVEKEYWKLVKDNNTSLEVEYGADLSTLDQGSAFPSLAKNPVNPYS 424

  Fly   152 LDVWNIGRLDTILNLV-NTDYNII------IDGVNTAYLYFGMWKSSFAWHTEDMDLYSINYLHF 209
            .|.||       ||:: :|:.:::      :.|:...:||.||..|:|.||.||...||:||.|:
pombe   425 KDTWN-------LNVIASTNGSLLSYIDNPVSGITCPWLYVGMCFSTFCWHVEDNYTYSVNYQHY 482

  Fly   210 GAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKITQEAGEI 274
            |..|.||.||.....|.|:.|.:...:..::....|....|||:|..|::..:....|.|...|.
pombe   483 GDTKLWYGIPGDQAERFERAALDIAPDLVKKQKDLLYQLATMINPDELQKRGVDVYFIDQGPNEF 547

  Fly   275 MITFPFGYHAGFNHGFNGAESTNFASKRWIEYG 307
            :||||..:|||.|||||..|:.|||.|.|:..|
pombe   548 VITFPKSFHAGINHGFNINEAVNFAPKDWLLNG 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 46/115 (40%)
jmj2NP_593492.1 JmjN 59..100 CDD:128818
BRIGHT 126..218 CDD:128777
JmjC 455..571 CDD:202224 46/115 (40%)
zf-C5HC2 661..712 CDD:280996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I1302
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.