DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and kdm4c

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_012808166.1 Gene:kdm4c / 100127653 XenbaseID:XB-GENE-1011534 Length:1067 Species:Xenopus tropicalis


Alignment Length:420 Identity:214/420 - (50%)
Similarity:296/420 - (70%) Gaps:20/420 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSFADEEQNKVPRIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPRKSGYDIDNI 69
            :|...:|||...:||||||::|||::|:.|:.|:||:|||.|||||:.||.||.|::...|||  
 Frog     2 ASADSDEQNPTCKIMTFRPTFEEFKDFNKYLVYMESKGAHRAGLAKVIPPKEWKPKRHYDDID-- 64

  Fly    70 NMTIPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFDYDDLERKYWKNITY 134
            ::.|||||.|:|||..|::.|.|| |::.||:::|...|||..:.||.:.||:|||||||||:|:
 Frog    65 DLVIPAPIQQMVTGQSGLFTQYNI-QKKPMTVKEFRHMANSGRYCTPTYIDYEDLERKYWKNVTF 128

  Fly   135 ISPLYAADVKGSLSDEDLDVWNIGRLDTILNLVNTDYNIIIDGVNTAYLYFGMWKSSFAWHTEDM 199
            :.|:|.|||.|||.::.::.|||.||.|||::|..:..|.|:||||.||||||||::||||||||
 Frog   129 VPPIYGADVNGSLYEKGVEEWNISRLKTILDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDM 193

  Fly   200 DLYSINYLHFGAPKTWYAIPPAYGRRLEKLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPY 264
            |||||||||||.||:||.:||.:|:|||:||...|..::|.|:|:||||||:|||.:|:::.||:
 Frog   194 DLYSINYLHFGEPKSWYTVPPEHGKRLERLAQGFFPSSFQGCDAFLRHKMTLISPSILKKYGIPF 258

  Fly   265 NKITQEAGEIMITFPFGYHAGFNHGFNGAESTNFASKRWIEYGKRASICRCRSDMVKISMETFVR 329
            :|||||.||.|||||:|||||||||||.|||||||:.|||:|||.|.:|.|.:|||||||:.||:
 Frog   259 SKITQEPGEFMITFPYGYHAGFNHGFNCAESTNFATVRWIDYGKIAKLCSCSNDMVKISMDIFVK 323

  Fly   330 RFQPERYDNWLKGQDMGCHPEEPGKICAAAPPTL-----------NEYEKQENLRAAKSEEESPQ 383
            .||..||..|.:|:|: |..:.........|..:           ...:..::.|:...:.::|:
 Frog   324 IFQKSRYQLWKQGKDI-CTIDHTKPTTGPTPEVIAWNMKRSRRKKGALKSLQHTRSRSKKLKTPE 387

  Fly   384 KRGCSLAGNGCERNAESAED---VDDKASV 410
            .:...:|  |.|..|..|.|   |::|.:|
 Frog   388 DKKTVVA--GAEILATEATDDFKVNNKPTV 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729 26/41 (63%)
JmjC 182..298 CDD:202224 82/115 (71%)
kdm4cXP_012808166.1 JmjN 15..56 CDD:301729 26/40 (65%)
JmjC 176..292 CDD:202224 82/115 (71%)
PHD_JMJD2C 655..757 CDD:277052
PHD_SF 766..875 CDD:304600
TUDOR 888..944 CDD:197660
TUDOR 946..1001 CDD:197660
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 213 1.000 Domainoid score I2696
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1186832at2759
OrthoFinder 1 1.000 - - FOG0000582
OrthoInspector 1 1.000 - - mtm9425
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.