DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm4A and brd1b

DIOPT Version :9

Sequence 1:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_005163199.1 Gene:brd1b / 100009661 ZFINID:ZDB-GENE-070209-98 Length:1168 Species:Danio rerio


Alignment Length:161 Identity:37/161 - (22%)
Similarity:57/161 - (35%) Gaps:55/161 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 CHPEEPGKICAAAPPTLNEYEKQEN---LRAAKSEEESPQKRGCSLAGNGCERNAESAEDVDDKA 408
            |.|..|... ...|.|:.:..|.:|   .:||..|    :.:||....|   :..||..|.    
Zfish   383 CCPHTPNGF-VRRPLTIYDDSKSKNGVCQKAAHRE----RVKGCQKKKN---KKPESEPDT---- 435

  Fly   409 SVSSYSSCRQLQPVVKLRKLPTIASVPEPSSAPKRYDFNT---EAVVRVKRLWNELPCPDRGANL 470
                              .:||::.   ||..||  .|||   :..|:.||::.|        .:
Zfish   436 ------------------VVPTVSG---PSITPK--SFNTILNQVSVQKKRMFVE--------RV 469

  Fly   471 LTNGVVKNTKR------MRFQTKVLTLDDED 495
            |:..::|...|      .|.||.:.|..|.:
Zfish   470 LSYWMLKRQSRNGVPLIRRLQTAIQTQKDPE 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224
brd1bXP_005163199.1 EPL1 45..193 CDD:287484
PHD_BRPF2 211..264 CDD:277147
PHD_SF 268..386 CDD:304600 1/2 (50%)
Bromo_brd1_like 559..656 CDD:99944
PWWP 1042..1157 CDD:295359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.