DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or94a

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:393 Identity:81/393 - (20%)
Similarity:162/393 - (41%) Gaps:44/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSNAYMMETLRNSGL---NLKNDFGIGRKIWRVFSF---TYNMVI-LPVSFPINYVIHLAEFPPE 78
            :|...:::.::..||   :||::     :.|....|   .|..:: ||::|....::.|..|...
  Fly     9 ESMRLILQVMQLFGLWPWSLKSE-----EEWTFTGFVKRNYRFLLHLPITFTFIGLMWLEAFISS 68

  Fly    79 LLLQSLQ-LCLNTWCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVRDMVATITRLYL 142
            .|.|:.| |.::....||....|.::.:|.| |.:...||..........::..|......|.:.
  Fly    69 NLEQAGQVLYMSITEMALVVKILSIWHYRTE-AWRLMYELQHAPDYQLHNQEEVDFWRREQRFFK 132

  Fly   143 TFVVVYVLYATSTLLDG------LLHHRVPYNTYYPFINWRVDRTQMYIQSFLEYFTVGYAIYVA 201
            .|..:|:|.:...:..|      |..:.:|:..|.|| .|:.:|..        :|..||.:...
  Fly   133 WFFYIYILISLGVVYSGCTGVLFLEGYELPFAYYVPF-EWQNERRY--------WFAYGYDMAGM 188

  Fly   202 TAT-------DSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCIKAHRTMLN 259
            |.|       |:....::    .||.||. |::.|.....:...:.:...:.|......|:.:.:
  Fly   189 TLTCISNITLDTLGCYFL----FHISLLY-RLLGLRLRETKNMKNDTIFGQQLRAIFIMHQRIRS 248

  Fly   260 FCDAIQPIISGTIFAQFIICGSILGI--IMINMVLFADQSTRF-GIVIYVMAVLLQTFPLCFYCN 321
            .....|.|:|..|.:|.|:...|:..  ..:..|...|...:| .::.:|..::||.:..|:|.|
  Fly   249 LTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGN 313

  Fly   322 AIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTV 386
            .|.....:|.:.::|:.|.......::.:..:::.|::|:|..|.|.|.:.|...:.....|::.
  Fly   314 EITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSF 378

  Fly   387 YAI 389
            .|:
  Fly   379 LAL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 61/304 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 66/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.