DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or85f

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:379 Identity:65/379 - (17%)
Similarity:151/379 - (39%) Gaps:52/379 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YNMVILPVSFPINYVIHLAEFPPELLLQSLQLCLNTWCF-------------ALKFFTLIVYTHR 106
            |:|:.:|.:.....:..:..|   |.|.|..:|:....|             .:::.||:.|.  
  Fly    24 YDMLGVPKTRSRRILYWIYRF---LCLASHGVCVGVMVFRMVEAKTIDNVSLIMRYATLVTYI-- 83

  Fly   107 LELANKHFDELDKYCVKPAEKRKVRDMV--ATITRLY---------LTFVVVYVLYATSTLLDGL 160
            :....|....|.:..::.... |:.::.  .|:.|:|         .:||.:.::|..|:::..:
  Fly    84 INSDTKFATVLQRSAIQSLNS-KLAELYPKTTLDRIYHRVNDHYWTKSFVYLVIIYIGSSIMVVI 147

  Fly   161 -----------LHHRVPYNTYYPFINW--RVDRTQMYIQSF-LEYFTVGYAIYVATATDSYPVIY 211
                       .|:...|...||:..:  ..|...:||..: ||:......:......|.:.:.:
  Fly   148 GPIITSIIAYFTHNVFTYMHCYPYFLYDPEKDPVWIYISIYALEWLHSTQMVISNIGADIWLLYF 212

  Fly   212 VAALRTHILLLKDRIIYLGD--PSNEGSSDPSYMFKSLVDCIKAHRTMLNFCDAIQPIISGTIFA 274
            ...:..|   .:..|..|.|  ||.:...:.......:|| .:.|  :::..:.:..|...::..
  Fly   213 QVQINLH---FRGIIRSLADHKPSVKHDQEDRKFIAKIVD-KQVH--LVSLQNDLNGIFGKSLLL 271

  Fly   275 QFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQTFPLCFYCNAIVDDCKELAHALFHSAW 339
            ..:...:::..:.:..::.......|..||::...::|.:.:|:|...::|...|:|||:::..:
  Fly   272 SLLTTAAVICTVAVYTLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDF 336

  Fly   340 WVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYAIASGM 393
            ......|:|.::..:.:.|||:...||...:|:|.|...:...::.|..:...|
  Fly   337 HDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 54/315 (17%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 54/321 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.