DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or85e

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:386 Identity:75/386 - (19%)
Similarity:139/386 - (36%) Gaps:113/386 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 WCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVRDMVATIT--------RLYLTFVVV 147
            ||  |:...|:.|...:....:|..                  :|.:|        |:...|.||
  Fly   117 WC--LRSRRLLAYMEHMNREYRHHS------------------LAGVTFVSSHAAFRMSRNFTVV 161

  Fly   148 YVL--------YATSTLLDGLLHHRVPYNTYYPF------INWRVDRTQMYIQSFLEY-FTVGYA 197
            :::        :..|.|:.|:  ..:|...:|||      ....|..||::.|..:.. |..|.:
  Fly   162 WIMSCLLGVISWGVSPLMLGI--RMLPLQCWYPFDALGPGTYTAVYATQLFGQIMVGMTFGFGGS 224

  Fly   198 IYVATA---TDSYPVIYVAA--LRTHILLLKDRII----------YLGDPSNE------------ 235
            ::|..:   ...:.|:|.:.  |..|..||....:          .|||...|            
  Fly   225 LFVTLSLLLLGQFDVLYCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKRELNQYVLLQEHPT 289

  Fly   236 -------GSSDP---SYMFKSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINM 290
                   |...|   :....:||:||:.||.:|:....::     .:|:.:.:..|:.....:.:
  Fly   290 DLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQELE-----NLFSPYCLVKSLQITFQLCL 349

  Fly   291 VLFADQS-TR--FGIVIYVMAVLLQTFPLCF--YCNAIVDDCKELAH------ALFHSAWWVQDK 344
            ::|...| ||  ..||..:..:.|..|.|..  ||..::.     .|      |.:..|||....
  Fly   350 LVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYCGELLS-----RHSIRSGDAFWRGAWWKHAH 409

  Fly   345 RYQRTVIQFLQKLQQPMTFTA--MNIFNINLATNINVAKFAFTVYAIASGMNLDQKLSIKE 403
            ..::.::.||...::.:..||  ..:.::|...::....|:|        :.|.|||:.|:
  Fly   410 FIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSF--------LTLLQKLAAKK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 67/361 (19%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 65/358 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.