DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or85b

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:277 Identity:60/277 - (21%)
Similarity:121/277 - (43%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 VATITRLYLTFVVVY-VLYATSTLL--------DGLLHHRV-----PYNTYYPFINWRVDRTQMY 184
            :.|.:|:.|.:.::| ||..|..|.        |..|:.||     ||..|.|: .|: |....|
  Fly   121 LGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPW-KWQ-DNWSYY 183

  Fly   185 IQSFLEYFTVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGD--PSNEGSSDPSYMFKSL 247
            ...|.:.|    |.|.:.|......:.:.|:.|.:::..|   :|.:  ..:|.|.|.....:.|
  Fly   184 PLLFSQNF----AGYTSAAGQISTDVLLCAVATQLVMHFD---FLSNSMERHELSGDWKKDSRFL 241

  Fly   248 VDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQ 312
            ||.::.|..:|...||:..|....:...|::...::..:...|.:.........:.:::::.:.|
  Fly   242 VDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQ 306

  Fly   313 TFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIF-NINLATN 376
            .:.:|.|...:.|.....:.|.::..|:..|.||:|.::..:.: .|.:||....|| :|..:|.
  Fly   307 VYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIAR-SQKVTFLKATIFLDITRSTM 370

  Fly   377 INVAKFAFTVYAIASGM 393
            .::.:.::..:|:...|
  Fly   371 TDLLQISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 58/266 (22%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 58/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.