DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or83c

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:342 Identity:58/342 - (16%)
Similarity:124/342 - (36%) Gaps:87/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KFFT----------LIVYTHRLELANKHFDEL----DKYCVKPAEKRKVRDMVATITRL------ 140
            ||.|          |::|:..:      :||.    |.|         .|.:.:.|.||      
  Fly    84 KFLTCLLKHQDMRRLVLYSQSI------YDEYETRGDSY---------HRTLNSNIDRLLGIMKI 133

  Fly   141 -----YLTFVVVYVLYATSTLLDG----LLHHRVP----YNTYYPFINWRVDRTQMYIQSFLEYF 192
                 ...|.::.:|.....:.||    .:.:.:|    .|.|...:.:.:....|.:|      
  Fly   134 IRNGYVFAFCLMELLPLAMLMYDGTRVTAMQYLIPGLPLENNYCYVVTYMIQTVTMLVQ------ 192

  Fly   193 TVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGD---------------PSNEGSSDPSY 242
              |...|   :.|.:..:.:..:.|...:|:.::..|.|               .|.:|:.:.. 
  Fly   193 --GVGFY---SGDLFVFLGLTQILTFADMLQVKVKELNDALEQKAEYRALVRVGASIDGAENRQ- 251

  Fly   243 MFKSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVM 307
              :.|:|.|:.|:...::|.||..:....|..|      :|.:.:..|:.|....:.|.:...:.
  Fly   252 --RLLLDVIRWHQLFTDYCRAINALYYELIATQ------VLSMALAMMLSFCINLSSFHMPSAIF 308

  Fly   308 AVLLQTFPLCFYC--NAIVDDCKELAHALFHSAWWVQDKRYQRTVIQF-LQKLQQPMTFTAMNIF 369
            .| :..:.:..||  ..|::...:..:....:..|.:....||.:..| |::.|.|.....:.:.
  Fly   309 FV-VSAYSMSIYCILGTILEFAYDQVYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQILGVM 372

  Fly   370 NINLATNINVAKFAFTV 386
            ::::.|.:.:.|..::|
  Fly   373 SLSVRTALQIVKLIYSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 57/338 (17%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 57/338 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.