DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or59c

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:413 Identity:126/413 - (30%)
Similarity:209/413 - (50%) Gaps:38/413 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FKLVYPAPISEPIQSRDSNAYMMETLRNSGLNLKNDFGIG------------RKIWRVFSFTYNM 57
            ||.:..||:.:.:.|.|::.|.....          |.:|            ..:|.:.:....:
  Fly     6 FKRLQTAPLDQEVSSLDASDYYYRIA----------FFLGWTPPKGALLRWIYSLWTLTTMWLGI 60

  Fly    58 VILPVSFPINYVIHLAEFPPELLLQSLQLCLNTWCFALKFFTLIVYTH--RLELANKHFDELDKY 120
            |.||:...:.||.|...|.|...|.|||:.:|  |......:.:.|:.  |....|:....|||.
  Fly    61 VYLPLGLSLTYVKHFDRFTPTEFLTSLQVDIN--CIGNVIKSCVTYSQMWRFRRMNELISSLDKR 123

  Fly   121 CVKPAEKRKVRDMVATITRLYLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYI 185
            ||...::|....|||.:..:.:.|:..|:.:...||...:...:.|:..|.|.::||....|::|
  Fly   124 CVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLFTSVFAGKAPWQLYNPLVDWRKGHWQLWI 188

  Fly   186 QSFLEYFTVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYM----FKS 246
            .|.|||..|.........:|:|.:::::..|.|:.:|:|||..|       ..||...    ::.
  Fly   189 ASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILRDRIANL-------RQDPKLSEMEHYEQ 246

  Fly   247 LVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQS-TRFGIVIYVMAVL 310
            :|.||:.|||::.....|:||:|.||||||::.|..||:..|:::.|.:.. |....|.:::|:.
  Fly   247 MVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFFPNTIWTIMANVSFIVAIC 311

  Fly   311 LQTFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLAT 375
            .::||.|..|..:::|...:::|||||.|...|:.|:..|:.||.:.|||:.|||.:||.|::.:
  Fly   312 TESFPCCMLCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQS 376

  Fly   376 NINVAKFAFTVYAIASGMNLDQK 398
            ||.|||||||:..|.:.|||.:|
  Fly   377 NIAVAKFAFTIITIVNQMNLGEK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 94/295 (32%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 101/314 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468559
Domainoid 1 1.000 64 1.000 Domainoid score I17159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I7489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31412at7147
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.