DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or49a

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:352 Identity:71/352 - (20%)
Similarity:138/352 - (39%) Gaps:62/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LAEFPPELLLQSLQL--CLNTWCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVRDMV 134
            ||..|.:::.|.|..  .|::   .|||.|.::...||...:....||  |..|...:||..   
  Fly    66 LAGSPSKIMRQGLHFFYMLSS---QLKFITFMINRKRLLQLSHRLKEL--YPHKEQNQRKYE--- 122

  Fly   135 ATITRLYL---TFVVVYVLY------ATSTLLDGLLHHRV-------PYNTYYPF-INWRVDRTQ 182
              :.:.||   |..|:||.|      |...|:...:.:.:       .|...:|. :.:..::..
  Fly   123 --VNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPL 185

  Fly   183 MYIQSFLEYFTVG-YAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKS 246
            .|:.:::..||.. :.:.|:..||.:.:...:.:..|:..|.:.:..:.........|..:    
  Fly   186 GYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDF---- 246

  Fly   247 LVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMI--------------NMVLFADQS 297
            |...||.|:.|:.....:. .:.|.:.|..:...|.|...|.              .|:|||..:
  Fly   247 LASIIKRHQLMIRLQKDVN-YVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVA 310

  Fly   298 TRFGIVIYVMAVLLQTFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMT 362
            .:|    ||::         .:...::|....||.|.|.|.|:....||::.::..:.:.|:|:.
  Fly   311 AQF----YVVS---------SHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLE 362

  Fly   363 FTAMNIFNINLATNINVAKFAFTVYAI 389
            .:|..:..|:|.|...:....:..:|:
  Fly   363 ISARGVIIISLDTFKILMTITYRFFAV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 64/320 (20%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/320 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.