DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or23a

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:385 Identity:78/385 - (20%)
Similarity:174/385 - (45%) Gaps:53/385 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LKND-FGIGRKIWRVFS---------FTYNMVILPVSFPINYVIHLAEFPPELLLQ--------- 82
            ||.| |.:....||:..         ::::|::.       .:::|   |..:||:         
  Fly     7 LKIDYFRVQLNAWRICGALDLSEGRYWSWSMLLC-------ILVYL---PTPMLLRGVYSFEDPV 61

  Fly    83 ----SLQLCLNTWCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVRDMVATITRL--- 140
                ||.|.:.:....:||...:....::........:||......::..:.|:|...:.|:   
  Fly    62 ENNFSLSLTVTSLSNLMKFCMYVAQLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHLLRMSKL 126

  Fly   141 -YLTFVVVYVLYATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYIQSFLEYFTVGYAIYV--AT 202
             .:|:.||:::.|...:.:..|  .:|...::|| :|: :....||.: |.:..:||...:  ..
  Fly   127 FQITYAVVFIIAAVPFVFETEL--SLPMPMWFPF-DWK-NSMVAYIGA-LVFQEIGYVFQIMQCF 186

  Fly   203 ATDSYP--VIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCIKAHRTMLNFCDAIQ 265
            |.||:|  |:|:.:.:..:|:|:...|..|..:.|.:.      :.||:||:....:....|..:
  Fly   187 AADSFPPLVLYLISEQCQLLILRISEIGYGYKTLEENE------QDLVNCIRDQNALYRLLDVTK 245

  Fly   266 PIISGTIFAQFIICGSILGIIMINMVLFADQ-STRFGIVIYVMAVLLQTFPLCFYCNAIVDDCKE 329
            .::|..:..||::.|..:.|.:..::.:.:. ..|...:.:::.:.:||:|||:|...:.:...|
  Fly   246 SLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYLCFLLGITVQTYPLCYYGTMVQESFAE 310

  Fly   330 LAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYAI 389
            |.:|:|.|.|..|...|:..::...::.::.....|.|:..|:|:|.:...|.|::.:.:
  Fly   311 LHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHLSTYVACWKGAYSFFTL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 63/297 (21%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 66/316 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.