DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or10a

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:349 Identity:70/349 - (20%)
Similarity:135/349 - (38%) Gaps:57/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QSLQLCLNTWCFA-------LKFFTLIVYTHRLELANKHFDEL--DKYCVKPAEKRKVR----DM 133
            |.:.|.|.|.|.|       ||.|.::.:...|.:.......|  |....:| |:|.:|    .|
  Fly    69 QQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERP-EQRDIRLKHSAM 132

  Fly   134 VATITRLYLT-------------FVVVYVLYATSTLLDGLLHHRVPYN-------TYYPFINWRV 178
            .|.|....|:             .::..:||..:...|.:..  .|:|       ..|||.    
  Fly   133 AARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWF--TPFNMTMPKVLLNYPFF---- 191

  Fly   179 DRTQMYIQSFLEYFTVGY-AIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDP-SNEGSSDPS 241
              ...||  |:.|  .|| .|::....|.:...:.|.|.....:|:..|..:..| ::.....|.
  Fly   192 --PLTYI--FIAY--TGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHLELSPV 250

  Fly   242 YMF---KSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIV 303
            .::   :.:...|..|..:::.....:...:....|.|:....::|..|:|::...:..  .|.:
  Fly   251 QLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNG--LGAM 313

  Fly   304 IYV---MAVLLQTFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTA 365
            :||   :|.|.|....|:....:.:....|..|:|...|.:...:.:|.|...:.:.|:|::. |
  Fly   314 LYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-A 377

  Fly   366 MNIFNINLATNINVAKFAFTVYAI 389
            :..|:.:|||...:.:.:.::.|:
  Fly   378 VPFFSPSLATFAAILQTSGSIIAL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 63/322 (20%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 68/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.