DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43b and Or9a

DIOPT Version :9

Sequence 1:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:322 Identity:67/322 - (20%)
Similarity:122/322 - (37%) Gaps:40/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 WCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVRDMVATITRLY-----LTFVVVYVL 150
            :|:..|.|..::|..|..||.:.....|...:...|.:..:.:..|.||.:     ...:..:|.
  Fly    92 FCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVG 156

  Fly   151 YATSTLLDGLLHHRVPYNTYYPFINWRVDRTQMYIQSFLEYFTVGY-AIYVATATDSYPVIYVAA 214
            ...|::....:|..:|:|..||:   .:.....|:.::|......| |:.:|...||....:...
  Fly   157 IILSSIRGDEIHLELPHNGVYPY---DLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYN 218

  Fly   215 LRTHILLLKDRIIYLGDPSNEGSSDPSYMFKSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIIC 279
            :.....:.|.|:|:|  |:..|..:    .:.||..:..|:..|...|.|.......||.||.: 
  Fly   219 VCAIFKIAKHRMIHL--PAVGGKEE----LEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFL- 276

  Fly   280 GSILGIIMINMV---LFAD-QSTRFGIVIYVMAVLLQTFPLCFYCNAIVDDCKE--------LAH 332
             |.|.|..|...   ||.: ||..|  :.:|.::|:..|        |...|.|        ..:
  Fly   277 -SALQICFIGFQVADLFPNPQSLYF--IAFVGSLLIALF--------IYSKCGENIKSASLDFGN 330

  Fly   333 ALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIFNINLATNINVAKFAFTVYAIASGMN 394
            .|:.:.|.......:|.::....:.|:|...... .|..::||...:.:.|.:...:....|
  Fly   331 GLYETNWTDFSPPTKRALLIAAMRAQRPCQMKGY-FFEASMATFSTIVRSAVSYIMMLRSFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 64/306 (21%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 65/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.