DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul1 and AT3G46910

DIOPT Version :9

Sequence 1:NP_523655.1 Gene:Cul1 / 35742 FlyBaseID:FBgn0015509 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_190275.1 Gene:AT3G46910 / 823844 AraportID:AT3G46910 Length:247 Species:Arabidopsis thaliana


Alignment Length:256 Identity:54/256 - (21%)
Similarity:98/256 - (38%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VNLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDY-CTSVSAAPSGRSSGKTGGAQLVGKK 77
            :.::|.|:.|...|..:|..|..              |: |:.:..|.:.....|:.|..|. |.
plant    24 IYVEDAWTMLKPAIRAIFLDEPQ--------------DFACSGLFNAVNKSWCEKSSGEALY-KL 73

  Fly    78 LYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQW----KSYQFSSTVLDGICNYLNRNWVKR 138
            :.:..|.::.:.:..|  :.:..:...:.||...|.|    :..||..::..|            
plant    74 ILEECEIYISAAIQSL--ESQCDTDPSLFLSLLEKCWLDFRRKLQFLCSIAGG------------ 124

  Fly   139 ECEEGQK-GIYKIYRLALVAWKGHLF--QVLNEPVTKAVLKSIEEERQGKLIN----RSLVRDVI 196
               |||. |.:.::.|.......|||  |.:.:.:...:|:.|.::|....::    ::..|.|:
plant   125 ---EGQTVGPHSVWDLGSELSPKHLFSAQKVRDKLLSIILQLIRDQRSFMSVDMTQLKNTTRPVM 186

  Fly   197 ECYVELSFNEEDTDAEQQKLSVYKQNFENK-FIADTSAFYEKESDAFLSTNTVTEYLKHVE 256
            ..::....|.......|   |:||..|..| ||.....||..|:..|...:.:..|||.||
plant   187 SVHMTQLNNLRGLFYGQ---SLYKSPFFKKPFIDCAVEFYSAEAMQFKEQSDIPLYLKRVE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul1NP_523655.1 Cullin 21..669 CDD:279260 52/249 (21%)
CULLIN 454..593 CDD:214545
Cullin_Nedd8 701..765 CDD:214883
AT3G46910NP_190275.1 Cullin 33..>244 CDD:279260 50/245 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.