DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul1 and Cacul1

DIOPT Version :9

Sequence 1:NP_523655.1 Gene:Cul1 / 35742 FlyBaseID:FBgn0015509 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_006231740.1 Gene:Cacul1 / 365493 RGDID:1308127 Length:377 Species:Rattus norvegicus


Alignment Length:253 Identity:53/253 - (20%)
Similarity:94/253 - (37%) Gaps:83/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 LDKACGKFINSNVVTIANSASKSPELLAKYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIED-- 457
            ::.:..||: .||:||.:..|.....|....|.||.:|   |.|        .:.:.::.|..  
  Rat   123 INTSTSKFL-MNVITIEDYKSTYWPKLDGAIDQLLTQS---PGD--------YIPISYEQIYSCV 175

  Fly   458 -KDVFQKYYSKM---LAKRLVNHTS-ASDDAEA----MMISKLKQTCG----------------- 496
             |.|.|::..:|   |.|::.:|.. .|.:.:|    :.|.:.....|                 
  Rat   176 YKCVCQQHSEQMYSDLIKKITSHLERVSKELQASPPDLYIERFNIALGQYMGALQSIVPLFIYMN 240

  Fly   497 -YEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNN-------- 552
             :....||.|..:|     ||...|.:::|||::...:..   :|.:.|.|||::.:        
  Rat   241 KFYIETKLNRDLKD-----DLIKLFTEHVAEKHIYSLMPL---LLEAQSTPFQVTPSTMANIVKG 297

  Fly   553 --FLLPSELERSVRQFNEF---------------YAARHSGRKLNWLYQMCKGELIMN 593
              .|.|..::.:...|::|               |||:.         |..:.|||.|
  Rat   298 LYTLRPEWVQMAPTLFSKFIPNILPPAVESELSEYAAQD---------QKLQRELIQN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul1NP_523655.1 Cullin 21..669 CDD:279260 53/253 (21%)
CULLIN 454..593 CDD:214545 38/192 (20%)
Cullin_Nedd8 701..765 CDD:214883
Cacul1XP_006231740.1 Cullin 146..>264 CDD:279260 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.