DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul1 and LOC108180715

DIOPT Version :9

Sequence 1:NP_523655.1 Gene:Cul1 / 35742 FlyBaseID:FBgn0015509 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_021324604.1 Gene:LOC108180715 / 108180715 -ID:- Length:80 Species:Danio rerio


Alignment Length:62 Identity:16/62 - (25%)
Similarity:30/62 - (48%) Gaps:6/62 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 RNNSSTYTLQASTFQMSVLLQFN----DQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVLT 653
            :|....|.|:.:|||::||..:|    :::||  :.|:..|:.....|.:.|.:.......|
Zfish     9 KNEVGQYDLEVTTFQLAVLFAWNQRPREKISF--ENLKLATELPDAELRRTLWVRASRSTFT 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul1NP_523655.1 Cullin 21..669 CDD:279260 16/62 (26%)
CULLIN 454..593 CDD:214545
Cullin_Nedd8 701..765 CDD:214883
LOC108180715XP_021324604.1 Cullin <1..59 CDD:331336 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.