DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul1 and cacul1

DIOPT Version :10

Sequence 1:NP_523655.1 Gene:Cul1 / 35742 FlyBaseID:FBgn0015509 Length:774 Species:Drosophila melanogaster
Sequence 2:XP_003199807.2 Gene:cacul1 / 100538081 ZFINID:ZDB-GENE-170113-2 Length:276 Species:Danio rerio


Alignment Length:105 Identity:25/105 - (23%)
Similarity:40/105 - (38%) Gaps:36/105 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WSELVEGIMQVFEHEKSLTRS-------QYMRFYTHVYDYCTSVSAAPSGRSSGKTGGAQLVGKK 77
            |.:|...:      |..||:|       .|.:.|:|||. |.                .|...:.
Zfish    59 WPKLERAV------ELLLTQSPMEHISISYEQIYSHVYK-CV----------------CQQHSEL 100

  Fly    78 LYDRLEQFLKSYLSELLTKFKAISGEEVL------LSRYT 111
            ||:.|...:.|:|.::..:.:|...|.::      |||||
Zfish   101 LYNDLMWKITSHLEQVSAELQASPPEHLIENFNLALSRYT 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul1NP_523655.1 Cullin 20..673 CDD:459983 25/105 (24%)
Cullin_Nedd8 704..765 CDD:463146
cacul1XP_003199807.2 Cullin 59..>187 CDD:459983 25/105 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.