DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12159 and Fam174c

DIOPT Version :9

Sequence 1:NP_610330.1 Gene:CG12159 / 35741 FlyBaseID:FBgn0033232 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_081483.1 Gene:Fam174c / 69770 MGIID:1917020 Length:108 Species:Mus musculus


Alignment Length:118 Identity:31/118 - (26%)
Similarity:51/118 - (43%) Gaps:33/118 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SPGDAKAPEMVQPP-----GGLPVDDVHVERSPMSPDVDFPGQAVV---YILVGITSTAILLLIM 147
            :||.|:...:..||     |.||..|.              |.||:   |::.|:.....|..::
Mouse    16 NPGSAENSSLPGPPYNHTNGRLPDRDT--------------GSAVLRLFYVITGLCGLISLYFLI 66

  Fly   148 RVYRLRLSRAERKYGVQGDRANQELTPLPMAIEDVNSDEEDHTLFEVNRQNIR 200
            |.:||:.|: .|:||:..:....|        |..:.|.|:.|:||.  :|:|
Mouse    67 RAFRLKKSQ-RRRYGLLTNTEEHE--------EMASQDSEEETVFET--RNLR 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12159NP_610330.1 DUF1180 40..195 CDD:284165 29/111 (26%)
Fam174cNP_081483.1 DUF1180 <18..108 CDD:369034 29/114 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..108 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_112627
Panther 1 1.100 - - LDO PTHR28607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.