DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12159 and Fam174a

DIOPT Version :9

Sequence 1:NP_610330.1 Gene:CG12159 / 35741 FlyBaseID:FBgn0033232 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_080597.2 Gene:Fam174a / 67698 MGIID:1914948 Length:190 Species:Mus musculus


Alignment Length:213 Identity:49/213 - (23%)
Similarity:83/213 - (38%) Gaps:59/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CFCLVAAALLLLFFHQQSCDAATQTPQKTV-VIAEQSAPAAEVEAKKPV-------VKKSQAENP 61
            |..|..|.:|||.   .:...:...|...| .:.|..:|........|:       ..:.||::.
Mouse    11 CHFLAPAFVLLLL---PALSGSGAVPSMVVREVQESKSPKPGPHTLSPLPPGPTAAQPRGQAQSD 72

  Fly    62 PAG------PKDSMVVVD------DGGPAPVAPGASVATQVSPGDAKAPEMVQPPGGLPVDDVHV 114
            .||      ..||:....      :|.....:.|.|:|...||||                    
Mouse    73 AAGLPGAESRNDSIPGAGSEADGLEGKAGEGSQGGSLAVSPSPGD-------------------- 117

  Fly   115 ERSPMSPDVDFPGQAVVYILVGITSTAILLLIMRVYRL-RLSRAERKYGV-QGDRANQELTPLPM 177
              .||:       |..:.:||.:::..::..::|..|: |.:|..|:||| ..:..|.|||||  
Mouse   118 --KPMT-------QRALTVLVVVSAAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPL-- 171

  Fly   178 AIEDVNSDEEDHTLFEVN 195
               :.:.:::|:|||:.|
Mouse   172 ---EQDDEDDDNTLFDAN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12159NP_610330.1 DUF1180 40..195 CDD:284165 39/175 (22%)
Fam174aNP_080597.2 DUF1180 10..190 CDD:284165 49/213 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..119 18/103 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..190 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28607
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.