DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12159 and fam174a

DIOPT Version :9

Sequence 1:NP_610330.1 Gene:CG12159 / 35741 FlyBaseID:FBgn0033232 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001017124.1 Gene:fam174a / 549878 XenbaseID:XB-GENE-6538612 Length:146 Species:Xenopus tropicalis


Alignment Length:146 Identity:44/146 - (30%)
Similarity:62/146 - (42%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PAGPKDSMVVV-------DDGGPAPVAPGASVA--TQVSPGDAKAPEMVQPPGGLPVDDVHVERS 117
            |.|....|::|       .|.|.|...|.||.|  |...|...:.........|.|:..|....|
 Frog     8 PQGSAGGMLLVLLAFCLLGDAGCALSPPAASPALPTAHLPLSPRKGSNSSTAAGAPLATVPSATS 72

  Fly   118 PMSPDVDFPGQAVVYILVGITSTAILLLIMRVYRL-RLSRAERKYGV-QGDRANQELTPLPMAIE 180
            |..|..    |..:.:||.:::..|:..::|..|. |.::..||||| ..:..|.|||||.    
 Frog    73 PNKPRT----QRALVVLVLVSAAVIIYFVIRTMRTRRKNKKTRKYGVLDTNLGNMELTPLE---- 129

  Fly   181 DVNSDEEDHTLFEVNR 196
              ..||:|.|||:.|:
 Frog   130 --QDDEDDDTLFDANQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12159NP_610330.1 DUF1180 40..195 CDD:284165 43/143 (30%)
fam174aNP_001017124.1 DUF1180 <31..146 CDD:284165 38/123 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..75 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..146 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28607
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.