DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12159 and Fam174c

DIOPT Version :9

Sequence 1:NP_610330.1 Gene:CG12159 / 35741 FlyBaseID:FBgn0033232 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001102753.1 Gene:Fam174c / 500795 RGDID:1562114 Length:111 Species:Rattus norvegicus


Alignment Length:114 Identity:27/114 - (23%)
Similarity:48/114 - (42%) Gaps:19/114 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ATQVSPGDAKAPEMVQPPGGLPVDDVHVERSPMSPDVDFPGQAVVYILVGITSTAILLLIMRVYR 151
            ||..|..::..|       |:|....: ..|...||.......:.|::.|:.....|..::|.:|
  Rat    17 ATPDSAENSSRP-------GVPTGSQN-RTSGSLPDTGSAMLRLFYVITGLCGLVSLYFLIRAFR 73

  Fly   152 LRLSRAERKYGVQGDRANQELTPLPMAIEDVNSDEEDHTLFEVNRQNIR 200
            |:..: .|:||:..:....|        |..:.|.|:.|:||.  :|:|
  Rat    74 LKKPQ-RRRYGLLTNTEEHE--------EMASQDSEEETVFET--RNLR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12159NP_610330.1 DUF1180 40..195 CDD:284165 25/107 (23%)
Fam174cNP_001102753.1 DUF1180 <51..111 CDD:284165 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_112627
Panther 1 1.100 - - LDO PTHR28607
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.