DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12159 and FAM174B

DIOPT Version :9

Sequence 1:NP_610330.1 Gene:CG12159 / 35741 FlyBaseID:FBgn0033232 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_997329.2 Gene:FAM174B / 400451 HGNCID:34339 Length:159 Species:Homo sapiens


Alignment Length:175 Identity:41/175 - (23%)
Similarity:69/175 - (39%) Gaps:46/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VVIAEQSAPAAEV----EAKKPVVKKSQAENPPAGPKDSMVVVDDGGP-------APVAPGASVA 87
            :::|..:||||..    ....|..:..:...||.||          ||       :..|.|:..:
Human    14 LLLALLAAPAARASRAESVSAPWPEPERESRPPPGP----------GPGNTTRFGSGAAGGSGSS 68

  Fly    88 TQVSPGDAKAPEMVQPPGGLPVDDVHVERSPMSPDVDFPGQAVVYILVGITSTAILLLIMRVYR- 151
            :..|.|||....:......||.                 .:|.|.:....|:..|..|::||:| 
Human    69 SSNSSGDALVTRISILLRDLPT-----------------LKAAVIVAFAFTTLLIACLLLRVFRS 116

  Fly   152 -LRLSRAERKYGVQGDRANQ-ELTPLPMAIEDVNSDEEDHTLFEV 194
             .||.:. |||.:....|.: |:.||    .:.:.::||.|:|::
Human   117 GKRLKKT-RKYDIITTPAERVEMAPL----NEEDDEDEDSTVFDI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12159NP_610330.1 DUF1180 40..195 CDD:284165 40/169 (24%)
FAM174BNP_997329.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..74 10/53 (19%)
DUF1180 <75..158 CDD:284165 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28607
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.