DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgk and PRKCG

DIOPT Version :9

Sequence 1:NP_724619.2 Gene:Dgk / 35738 FlyBaseID:FBgn0085390 Length:1230 Species:Drosophila melanogaster
Sequence 2:NP_001303258.1 Gene:PRKCG / 5582 HGNCID:9402 Length:710 Species:Homo sapiens


Alignment Length:312 Identity:71/312 - (22%)
Similarity:114/312 - (36%) Gaps:82/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 HVWRLKHFSKPAYCNLCLNMLVGLGKKGLCCVLCKYTVHERCVQHAPASCITTYVKSKKPKCGGD 474
            |.:..:.|.:|.:|:.|.:.:.|:||:||.|.:|.:.||.||.:.....|...   .|.|:....
Human    36 HKFTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGA---GKGPQTDDP 97

  Fly   475 LLHHWVEGNCYGR---CSKCRKRIKAYHGIT--GLTCRWCHMMLHNRCASSVKKECTL------G 528
            ...|....:.|..   |..|...:   :|:.  |:.|..|.|.:|.||..||...|.:      |
Human    98 RNKHKFRLHSYSSPTFCDHCGSLL---YGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRG 159

  Fly   529 EYSELIVPPTAICPAVLDRQRSVNQAH----KATHFQITPPDELSCP---LLVFVNPKSGGRQGD 586
            .....|..|||            ::.|    :|.:.....|:.||.|   |.:..:|::..:|..
Human   160 RLQLEIRAPTA------------DEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKT 212

  Fly   587 RILRKFQYMLNP----RQVYDLSKGGPKEGLTLFKDLPRFRVICCGGDGTVGWVLEAMDSIELAS 647
            |.::.   .|||    ..|::|..|..:..|:                      :|..|....:.
Human   213 RTVKA---TLNPVWNETFVFNLKPGDVERRLS----------------------VEVWDWDRTSR 252

  Fly   648 QPAIGVIPLGTGNDLARCLRWGGGY------EGE--NIP-------KLMDKF 684
            ...:|.:..|....|...:  .|.|      |||  |:|       .|:.||
Human   253 NDFMGAMSFGVSELLKAPV--DGWYKLLNQEEGEYYNVPVADADNCSLLQKF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkNP_724619.2 DAG_kinase_N 9..313 CDD:291199
EFh 317..386 CDD:238008
EF-hand_7 318..382 CDD:290234
C1 410..459 CDD:237996 16/48 (33%)
C1_1 477..528 CDD:278556 15/61 (25%)
DAGKc 573..694 CDD:214487 25/131 (19%)
DAGKa 1003..1194 CDD:214486
PRKCGNP_001303258.1 C1_1 36..88 CDD:278556 17/51 (33%)
C1_1 101..153 CDD:278556 15/54 (28%)
C2_PKC_alpha_gamma 158..289 CDD:175992 33/169 (20%)
S_TKc 351..614 CDD:214567
STKc_cPKC 354..677 CDD:270739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0696
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.