DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgk and PRKCA

DIOPT Version :9

Sequence 1:NP_724619.2 Gene:Dgk / 35738 FlyBaseID:FBgn0085390 Length:1230 Species:Drosophila melanogaster
Sequence 2:NP_002728.2 Gene:PRKCA / 5578 HGNCID:9393 Length:672 Species:Homo sapiens


Alignment Length:442 Identity:94/442 - (21%)
Similarity:146/442 - (33%) Gaps:149/442 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 VLLGVDST-------------TLKEDGIHVWR-----LKHFSKPAYCNLCLNMLVGLGKKGLCCV 441
            |..|.|||             .|::..:|..:     .:.|.:|.:|:.|.:.:.|.||:|..|.
Human     4 VFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQ 68

  Fly   442 LCKYTVHERCVQHAPASCITTYVKSKKPKCGGDLLHHWVEGNCYGR---CSKCRKRIKAYHGI-- 501
            :|.:.||:||.:....||...   .|.|........|..:.:.||.   |..|...:   :|:  
Human    69 VCCFVVHKRCHEFVTFSCPGA---DKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLL---YGLIH 127

  Fly   502 TGLTCRWCHMMLHNRCASSVKKECTLGE-------YSELIVPPTAICPAVLDRQRSVNQAHKATH 559
            .|:.|..|.|.:|.:|..:|...|.:..       |.:..|....:...|.|.:..:..      
Human   128 QGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPM------ 186

  Fly   560 FQITPPDELSCP---LLVFVNPKSGGRQGDRILRKFQYMLNPRQVYDLSKGGPKEGLTLFKDLP- 620
                .|:.||.|   |.:..:||:..:|..:.:|.   .|||:.         .|..| ||..| 
Human   187 ----DPNGLSDPYVKLKLIPDPKNESKQKTKTIRS---TLNPQW---------NESFT-FKLKPS 234

  Fly   621 ----RFRVICCGGDGTVGWVLEAMDSIELASQPAIGVIPLGTGNDLARCLRWG----------GG 671
                |..|.....|.|                         |.||....|.:|          |.
Human   235 DKDRRLSVEIWDWDRT-------------------------TRNDFMGSLSFGVSELMKMPASGW 274

  Fly   672 Y------EGE--NIP----------KLMDKFRRASTVMLDRWSIEVTNTPHSDDMRPKVTLHSNM 718
            |      |||  |:|          :|..||.:|.........|    :|..|..:|...|  :.
Human   275 YKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVI----SPSEDRKQPSNNL--DR 333

  Fly   719 QKVIELSQSVVVDKSLMERFEEIQRQSKQVATSMGTAASSTSIMMASKTETE 770
            .|:.:.:..:|:.|.                 |.|      .:|:|.:..||
Human   334 VKLTDFNFLMVLGKG-----------------SFG------KVMLADRKGTE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkNP_724619.2 DAG_kinase_N 9..313 CDD:291199
EFh 317..386 CDD:238008
EF-hand_7 318..382 CDD:290234
C1 410..459 CDD:237996 15/53 (28%)
C1_1 477..528 CDD:278556 14/55 (25%)
DAGKc 573..694 CDD:214487 32/153 (21%)
DAGKa 1003..1194 CDD:214486
PRKCANP_002728.2 C1_1 37..89 CDD:278556 16/51 (31%)
C1_1 102..154 CDD:278556 14/54 (26%)
C2_PKC_alpha_gamma 159..289 CDD:175992 36/177 (20%)
STKc_cPKC_alpha 328..668 CDD:270766 10/60 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0696
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.