DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgk and Pkc53E

DIOPT Version :9

Sequence 1:NP_724619.2 Gene:Dgk / 35738 FlyBaseID:FBgn0085390 Length:1230 Species:Drosophila melanogaster
Sequence 2:NP_725626.1 Gene:Pkc53E / 48311 FlyBaseID:FBgn0003091 Length:679 Species:Drosophila melanogaster


Alignment Length:221 Identity:52/221 - (23%)
Similarity:79/221 - (35%) Gaps:43/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 HVWRLKHFSKPAYCNLCLNML---------VGLGKKGLCCVLCKYTVHERCVQHAPASC--ITTY 463
            |.:..:.|.:|.:|:.|.:.:         :|.||:|..|.:|.|.||:||.::....|  ....
  Fly    46 HCFIARFFKQPTFCSHCKDFICGYQSGYAWMGFGKQGFQCQVCSYVVHKRCHEYVTFICPGKDKG 110

  Fly   464 VKSKKPKCGGDLLHHWVEGNCYGR---CSKCRKRIKA-YHGITGLTCRWCHMMLHNRCASSVKKE 524
            :.|..||     ..|..|...|..   |..|...:.. ||  .||.|..|.|.:|.||..:|...
  Fly   111 IDSDSPK-----TQHNFEPFTYAGPTFCDHCGSLLYGIYH--QGLKCSACDMNVHARCKENVPSL 168

  Fly   525 CTLGE-------YSELIVPPTAICPAVLDRQRSVNQAHKATHFQITPPDELSCPLLVFVNPKSGG 582
            |....       |.|:.|....:...:.:.:..:..          .|:.||.|.:.........
  Fly   169 CGCDHTERRGRIYLEINVKENLLTVQIKEGRNLIPM----------DPNGLSDPYVKVKLIPDDK 223

  Fly   583 RQGDRILRKFQYMLNP----RQVYDL 604
            .|..:..|..:..|||    ...|||
  Fly   224 DQSKKKTRTIKACLNPVWNETLTYDL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkNP_724619.2 DAG_kinase_N 9..313 CDD:291199
EFh 317..386 CDD:238008
EF-hand_7 318..382 CDD:290234
C1 410..459 CDD:237996 16/57 (28%)
C1_1 477..528 CDD:278556 17/54 (31%)
DAGKc 573..694 CDD:214487 8/36 (22%)
DAGKa 1003..1194 CDD:214486
Pkc53ENP_725626.1 C1_cPKC_rpt1 44..110 CDD:410383 17/63 (27%)
C1_cPKC_rpt2 120..173 CDD:410386 17/54 (31%)
C2_PKC_alpha_gamma 177..307 CDD:175992 15/83 (18%)
STKc_cPKC 353..672 CDD:270739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0696
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.