DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgk and Prkcb

DIOPT Version :9

Sequence 1:NP_724619.2 Gene:Dgk / 35738 FlyBaseID:FBgn0085390 Length:1230 Species:Drosophila melanogaster
Sequence 2:NP_036845.3 Gene:Prkcb / 25023 RGDID:3396 Length:673 Species:Rattus norvegicus


Alignment Length:201 Identity:49/201 - (24%)
Similarity:85/201 - (42%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 HVWRLKHFSKPAYCNLCLNMLVGLGKKGLCCVLCKYTVHERCVQHAPASCITTYVKSKKPKCGGD 474
            |.:..:.|.:|.:|:.|.:.:.|||.:|....:|.:.||:||.:....||...   .|.|.....
  Rat    37 HKFTARFFKQPTFCSHCTDFIWGLGLQGFQSQVCCFVVHKRCHEFVTFSCPGA---DKGPASDDP 98

  Fly   475 LLHHWVEGNCYGR---CSKCRKRIKAYHGI--TGLTCRWCHMMLHNRCASSVKKECTLGEYSE-- 532
            ...|..:.:.|..   |..|...:   :|:  .|:.|..|.|.:|.||..:|...|.. :::|  
  Rat    99 RSKHKFKIHTYSSPTFCDHCGSLL---YGLIHQGMKCDTCMMNVHKRCVMNVPSLCGT-DHTERR 159

  Fly   533 --LIVPPTAICPAVLDRQRSVNQAHKATHFQITPPDELSCP---LLVFVNPKSGGRQGDRILRKF 592
              :.:      .|.:||:..:.....|.:.....|:.||.|   |.:..:|||..:|..:.::  
  Rat   160 GRIYI------QAHIDREVLIVVVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIK-- 216

  Fly   593 QYMLNP 598
             ..|||
  Rat   217 -CSLNP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkNP_724619.2 DAG_kinase_N 9..313 CDD:291199
EFh 317..386 CDD:238008
EF-hand_7 318..382 CDD:290234
C1 410..459 CDD:237996 14/48 (29%)
C1_1 477..528 CDD:278556 14/55 (25%)
DAGKc 573..694 CDD:214487 7/26 (27%)
DAGKa 1003..1194 CDD:214486
PrkcbNP_036845.3 C1_1 37..89 CDD:278556 16/51 (31%)
C1_1 102..152 CDD:278556 13/52 (25%)
C2_PKC_alpha_gamma 159..289 CDD:175992 16/72 (22%)
STKc_cPKC_beta 341..663 CDD:270767
S_TKc 342..600 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0696
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.