Sequence 1: | NP_724619.2 | Gene: | Dgk / 35738 | FlyBaseID: | FBgn0085390 | Length: | 1230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032881.1 | Gene: | Prkcb / 18751 | MGIID: | 97596 | Length: | 673 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 50/201 - (24%) |
---|---|---|---|
Similarity: | 86/201 - (42%) | Gaps: | 28/201 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 410 HVWRLKHFSKPAYCNLCLNMLVGLGKKGLCCVLCKYTVHERCVQHAPASCITTYVKSKKPKCGGD 474
Fly 475 LLHHWVEGNCYGR---CSKCRKRIKAYHGI--TGLTCRWCHMMLHNRCASSVKKECTLGEYSE-- 532
Fly 533 --LIVPPTAICPAVLDRQRSVNQAHKATHFQITPPDELSCP---LLVFVNPKSGGRQGDRILRKF 592
Fly 593 QYMLNP 598 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dgk | NP_724619.2 | DAG_kinase_N | 9..313 | CDD:291199 | |
EFh | 317..386 | CDD:238008 | |||
EF-hand_7 | 318..382 | CDD:290234 | |||
C1 | 410..459 | CDD:237996 | 15/48 (31%) | ||
C1_1 | 477..528 | CDD:278556 | 14/55 (25%) | ||
DAGKc | 573..694 | CDD:214487 | 7/26 (27%) | ||
DAGKa | 1003..1194 | CDD:214486 | |||
Prkcb | NP_032881.1 | C1_cPKC_rpt1 | 35..92 | CDD:410383 | 17/57 (30%) |
C1_cPKC_rpt2 | 102..155 | CDD:410386 | 14/56 (25%) | ||
C2_PKC_alpha_gamma | 159..289 | CDD:175992 | 16/72 (22%) | ||
STKc_cPKC_beta | 341..663 | CDD:270767 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0696 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |