DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgk and pkc-2

DIOPT Version :9

Sequence 1:NP_724619.2 Gene:Dgk / 35738 FlyBaseID:FBgn0085390 Length:1230 Species:Drosophila melanogaster
Sequence 2:NP_001359883.1 Gene:pkc-2 / 181166 WormBaseID:WBGene00004033 Length:753 Species:Caenorhabditis elegans


Alignment Length:438 Identity:84/438 - (19%)
Similarity:151/438 - (34%) Gaps:127/438 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 HVWRLKHFSKPAYCNLCLNMLVGLGKKGLCCVLCKYTVHERCVQHAPASC--ITTYVKSKKPKCG 472
            |.:..:.|.:|.:|:.|.:.|.|:.|:|..|.:|...||:||.:....:|  ....|.:..|:  
 Worm   110 HKFIARFFKQPTFCSHCKDFLWGITKQGFQCQVCTLVVHKRCHEFVNFACPGADKGVDTDDPR-- 172

  Fly   473 GDLLHHWVEGNCYGR---CSKCRKRIKAYHGI--TGLTCRWCHMMLHNRCASSVKKECTLGEYSE 532
              ..|.| :...|..   |..|...:   :||  .|:.|:.|...:|:||..:|...|......:
 Worm   173 --QQHKW-KVQTYSSPTFCDHCGSLL---YGILHQGMKCQSCDTNVHHRCVKNVPNMCGTDNTEK 231

  Fly   533 LIVPPTAICPAVLDRQRSVNQAH-----------KATHFQITPPDELS-----CPLLVFVNPKSG 581
                          |.|...:||           :|.:.....|:.||     |.|:    |:..
 Worm   232 --------------RGRLRIEAHIENDQLTIKILEAKNLIPMDPNGLSDPYVKCKLI----PEDS 278

  Fly   582 GRQGDRILRKFQYMLNPRQVYDLSKGGPKEGLTLFKDLPRFRVICCGGDGTVGWVLEAMDSIELA 646
            |.:..:..:..:..|||:.         .|..| :|.||        ||......:|..|....:
 Worm   279 GCKSKQKTKTLRATLNPQW---------NETFT-YKLLP--------GDKDRRLSIEVWDWDRTS 325

  Fly   647 SQPAIGVIPLGTGNDLARCLRWGGGYEGENIPKLMDK-----FRRASTVMLDRWSIEVTNTPHSD 706
            ....:|.:..|                   |.:||.:     ::..|....:.::|.:  ||..|
 Worm   326 RNDFMGSLSFG-------------------ISELMKEAASGWYKLLSAEEGEFYNINI--TPEYD 369

  Fly   707 DMRPKVTLHSNMQKVIELSQSVVVDKSLMERFEEIQRQSKQV-------ATSMGTAASSTSIMMA 764
            :         :|:|         |.|.:.|.|......|.:.       |:::...:|:.:::.|
 Worm   370 E---------DMEK---------VRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKA 416

  Fly   765 SKTETEMETMATMEFGSSTTTTNRTT--------TTKSISMSTFETQC 804
            |.... :..:....||.......:||        ..|.:.:...:.:|
 Worm   417 SDFNF-LTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVEC 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkNP_724619.2 DAG_kinase_N 9..313 CDD:291199
EFh 317..386 CDD:238008
EF-hand_7 318..382 CDD:290234
C1 410..459 CDD:237996 15/48 (31%)
C1_1 477..528 CDD:278556 15/55 (27%)
DAGKc 573..694 CDD:214487 20/125 (16%)
DAGKa 1003..1194 CDD:214486
pkc-2NP_001359883.1 C1_1 110..160 CDD:365894 15/49 (31%)
C1_1 175..225 CDD:365894 14/53 (26%)
C2_PKC_alpha_gamma 232..362 CDD:175992 30/170 (18%)
STKc_cPKC 422..744 CDD:270739 6/42 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.