DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dgk and prkcba

DIOPT Version :9

Sequence 1:NP_724619.2 Gene:Dgk / 35738 FlyBaseID:FBgn0085390 Length:1230 Species:Drosophila melanogaster
Sequence 2:NP_957323.1 Gene:prkcba / 100006675 ZFINID:ZDB-GENE-040426-1354 Length:668 Species:Danio rerio


Alignment Length:244 Identity:59/244 - (24%)
Similarity:98/244 - (40%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 DADGTVSLDEWQRGGMTTIPLLVLLGVDSTTLKEDGIHVWR-----LKHFSKPAYCNLCLNMLVG 432
            |:||......:.|.|               .|::..:|..:     .:.|.:|.:|:.|.:.:.|
Zfish     6 DSDGKEGARGFARQG---------------ALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWG 55

  Fly   433 LGKKGLCCVLCKYTVHERCVQHAPASCITTYVKSKKPKCGGDLLHHWVEGNCYGR---CSKCRKR 494
            .||:|..|.:|.:.||:||.:....||..:   .|.|.......:|..:.:.|..   |..|...
Zfish    56 FGKQGFQCQVCCFVVHKRCHEFVHFSCPGS---DKGPASDDPRKYHSFKVHTYTSPTFCDHCGSL 117

  Fly   495 IKAYHGI--TGLTCRWCHMMLHNRCASSVKKECTLGEYSE---LIVPPTAICPAVLDRQRSVNQA 554
            :   :|:  .|:.|..|.|.:|.||...|...|.. :::|   .:....:|...||  ..||.:|
Zfish   118 L---YGLIHQGMRCLNCLMNIHKRCFKHVPSLCGT-DHTEKRGRLHFSASITGNVL--SVSVKEA 176

  Fly   555 HKATHFQITP--PDELSCP---LLVFVNPKSGGRQGDRILRKFQYMLNP 598
            .     .:.|  |..||.|   |.:..:|||..:|..:.::.   .|||
Zfish   177 R-----NLVPMDPSGLSDPYVKLKLIPDPKSESKQKTKTIKG---CLNP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DgkNP_724619.2 DAG_kinase_N 9..313 CDD:291199
EFh 317..386 CDD:238008 3/12 (25%)
EF-hand_7 318..382 CDD:290234 3/8 (38%)
C1 410..459 CDD:237996 15/53 (28%)
C1_1 477..528 CDD:278556 14/55 (25%)
DAGKc 573..694 CDD:214487 7/26 (27%)
DAGKa 1003..1194 CDD:214486
prkcbaNP_957323.1 C1_1 33..85 CDD:278556 16/51 (31%)
C1_1 98..148 CDD:278556 13/52 (25%)
C2_PKC_alpha_gamma 155..285 CDD:175992 19/73 (26%)
PKc_like 337..659 CDD:304357
S_TKc 338..596 CDD:214567
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0696
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.