DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12822 and TRMO

DIOPT Version :9

Sequence 1:NP_610327.1 Gene:CG12822 / 35737 FlyBaseID:FBgn0033229 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001358586.1 Gene:TRMO / 51531 HGNCID:30967 Length:441 Species:Homo sapiens


Alignment Length:428 Identity:143/428 - (33%)
Similarity:190/428 - (44%) Gaps:121/428 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GHCLGEDYAHFRPIGVIRTAFPEKRAVPRQSIVGSRLRGIIQLNDGVFTNPEHSLEGLEDFSHLW 154
            |:.|.|      |:|.:.:.|..|...|||..:.|..|..:::...:|.||||||.|||.|||:|
Human    26 GNLLTE------PVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVW 84

  Fly   155 LIYHFHRN-NSHPKAKVAPPRLGGERVGVFSTRSPHRPCPIGLSLVEIEKIENATISFFGTDMVD 218
            :::.||:| :...||||.||||.|.:.|||||||||||..|||:|.::||:|...|...|.||:.
Human    85 ILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIH 149

  Fly   219 GTPVLDIKPYIPHYDAPS---------------------LSVDSGT----------LDENQAEMQ 252
            |||||||||||..||:|.                     ...||.|          .||.|....
Human   150 GTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHS 214

  Fly   253 LKFLP-----RTGRTSVGPH--------------ESSLDF-YDSRQE--------------PD-- 281
            .|..|     ||...:...|              |.::|| .:||::              |:  
Human   215 TKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKS 279

  Fly   282 ----GEESDLE-LYGAAGYSGN------------AGIGADAILPPPSAVRVPNWV----VASNRL 325
                |.:..|| :.|||...|:            ||....|    |.:| ||.||    ||:  |
Human   280 FSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGA----PRSV-VPAWVTEAPVAT--L 337

  Fly   326 SVTFNEHAEAQLKELQVE----------------KQCIVDILEADPRSVYLRTKYGSQIFTFQLR 374
            .|.|..|||..|.:|..:                |:.|..:|.|||||||.|.....::|.|.:.
Human   338 EVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVD 402

  Fly   375 EVTVTCKFDDKAGTVTVVQVR-RNENVQVTALDGDLRS 411
            ...|||.|.|  |...|:::: .:|.|.:|...|.|.|
Human   403 IAHVTCWFGD--GFAEVLRIKPASEPVHMTGPVGSLVS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12822NP_610327.1 UPF0066 116..232 CDD:280205 64/116 (55%)
TRMONP_001358586.1 UPF0066 45..164 CDD:376698 64/118 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..231 10/51 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..284 1/19 (5%)
TrmO_C 335..403 CDD:375815 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159293
Domainoid 1 1.000 139 1.000 Domainoid score I4817
eggNOG 1 0.900 - - E1_COG1720
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3801
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483097at2759
OrthoFinder 1 1.000 - - FOG0005744
OrthoInspector 1 1.000 - - otm41071
orthoMCL 1 0.900 - - OOG6_101884
Panther 1 1.100 - - LDO PTHR12818
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5229
SonicParanoid 1 1.000 - - X4138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.