DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phr and CG18853

DIOPT Version :9

Sequence 1:NP_523653.2 Gene:phr / 35735 FlyBaseID:FBgn0003082 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_724615.1 Gene:CG18853 / 246511 FlyBaseID:FBgn0042173 Length:330 Species:Drosophila melanogaster


Alignment Length:310 Identity:189/310 - (60%)
Similarity:207/310 - (66%) Gaps:43/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 VASDKQEYAARTIRNKINSKLGEYLSVFPPVVRHPHGTGCKNVNTVDWSAAYASLQCDMEVDEVQ 313
            ||.:|||:..:  :...:.:.|:..|      .:.:|..|...:       ||..:   .:..::
  Fly    61 VAGEKQEHQHQ--QQTQDQQTGQGQS------NYTNGGHCLGED-------YAHFR---PIGVIR 107

  Fly   314 WAKPGYKAACQQLYEFCSRRLR---HFNDKRNDPTADALSGLSPWLHFGHISAQRCALEVQRFRG 375
            .|.|..:|..:|  .....|||   ..||........:|.||..:.|...|      ....|...
  Fly   108 TAFPEKRAVPRQ--SIVGSRLRGIIQLNDGVFTNPEHSLEGLEDFSHLWLI------YHFHRNNS 164

  Fly   376 QHKASADAFCEEAIVRRELADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSL 440
            ..||.              ||||||||||||||||||||||||||||||||||||||||||||||
  Fly   165 HPKAK--------------ADNFCFYNEHYDSLKGLSSWAYQTLDAHRKDKRDPCYSLEELEKSL 215

  Fly   441 TYDDLWNSAQLQLVREGKMHGFLRMYWAKKILEWTATPEHALEYAILLNDKYSLDGRDPNGYVGC 505
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   216 TYDDLWNSAQLQLVREGKMHGFLRMYWAKKILEWTATPEHALEYAILLNDKYSLDGRDPNGYVGC 280

  Fly   506 MWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDVNAFVMRYGGKVHKKK 555
            ||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   281 MWSIGGVHDMGWKERAIFGKVRYMNYQGCRRKFDVNAFVMRYGGKVHKKK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phrNP_523653.2 phr2 93..547 CDD:129679 179/300 (60%)
DNA_photolyase 117..278 CDD:279247 7/28 (25%)
CG18853NP_724615.1 UPF0066 100..>163 CDD:294485 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450666
Domainoid 1 1.000 314 1.000 Domainoid score I305
eggNOG 1 0.900 - - E1_COG0415
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.