DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phr and phr

DIOPT Version :9

Sequence 1:NP_523653.2 Gene:phr / 35735 FlyBaseID:FBgn0003082 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001135721.1 Gene:phr / 100216302 XenbaseID:XB-GENE-5753919 Length:157 Species:Xenopus tropicalis


Alignment Length:158 Identity:79/158 - (50%)
Similarity:102/158 - (64%) Gaps:11/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TKAQKAGPSKKAAKNE---KASSEPKSDQESSDEEASTSKALLVSKPDYQNFEQFL-THLEHQRV 84
            |||:....:|...|.:   |..||..|. ||||.:|...|.::     .|..|:.: ..::..||
 Frog     3 TKAKSKTITKSPGKRKTPGKVLSETSSG-ESSDVDAKKKKKMV-----EQTEEKGVGGAVKISRV 61

  Fly    85 CTAANIQEFSFRKKRVRVLSKTEDVKESSLGGVVYWMSRDGRVQDNWALLFAQRLALKLELPLTV 149
            ..|.::.||.|.|||||::|...|:|:.: .|:|||||||.|||||||.|:|||||||.:|||.|
 Frog    62 EAAPSVSEFKFNKKRVRLISTEADLKDDA-QGIVYWMSRDQRVQDNWAFLYAQRLALKQKLPLHV 125

  Fly   150 VFCLVPKFLNATIRHYKFMMGGLQEVEQ 177
            .||||||||:||||||.||:.|||||.:
 Frog   126 TFCLVPKFLDATIRHYGFMVKGLQEVAE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phrNP_523653.2 phr2 93..547 CDD:129679 58/85 (68%)
DNA_photolyase 117..278 CDD:279247 47/61 (77%)
phrNP_001135721.1 DNA_photolyase 93..>153 CDD:279247 45/59 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D985150at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.