DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phr and cry1a

DIOPT Version :9

Sequence 1:NP_523653.2 Gene:phr / 35735 FlyBaseID:FBgn0003082 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_001070765.2 Gene:cry1a / 100003956 ZFINID:ZDB-GENE-010426-2 Length:619 Species:Danio rerio


Alignment Length:405 Identity:82/405 - (20%)
Similarity:142/405 - (35%) Gaps:111/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VYWMSRDGRVQDNWALLFAQRLALKLELPLTVVFCLVPKFL---NATIRHYKFMMGGLQEVEQQC 179
            |:|..:..|:.||.:|    |.::.....:..|:.|.|.|.   |..|..::|::..|::::...
Zfish     6 VHWFRKGLRLHDNPSL----RDSILGAHSVRCVYILDPWFAGSSNVGISRWRFLLQCLEDLDASL 66

  Fly   180 RALDIPFHLLMGSAVEKLPQFVKSKDIGAVVCDFAPLRLPRQWVEDVGK----ALPK-----SVP 235
            |.|:....::.|...:..|:..|..:|..:..::..        |..||    |:.|     .|.
Zfish    67 RKLNSRLFVIRGQPTDVFPRLFKEWNINRLSYEYDS--------EPFGKERDAAIKKLANEAGVE 123

  Fly   236 LVQVDAHNVVPLWVASDK-------------------------QEYAARTIRNKINSKLGEYLSV 275
            ::...:|.:..|    ||                         .|..|.||..::.......|| 
Zfish   124 VIVRISHTLYDL----DKIIELNGGQSPLTYKRFQTLISRMEAVETPAETITAEVMGPCTTPLS- 183

  Fly   276 FPPVVRHPHGTGCKNVNTVDWSAAYASLQCDME-VDEVQWAKPGYKA-ACQQLYEFCSRRLRHFN 338
                ..|....|..::.         .|..|.| :....|  ||.:. |..:|.....|:....|
Zfish   184 ----DDHDEKFGVPSLE---------ELGFDTEGLSSAVW--PGGETEALTRLERHLERKAWVAN 233

  Fly   339 DKRNDPTADAL----SGLSPWLHFGHISAQRCAL------EVQRFRGQHKASADAFCEEAIVRRE 393
            .:|....|::|    :||||:|.||.:|   |.|      ::.| :.:..:|........::.||
Zfish   234 FERPRMNANSLLASPTGLSPYLRFGCLS---CRLFYFKLTDLYR-KVKKNSSPPLSLYGQLLWRE 294

  Fly   394 LADNFCFYNEHYDSLKG---------------LSSWA-----YQTLDAHRKDKRDPCYSLEELEK 438
            ........|..:|.::|               |:.||     :..:||.....|...: :..|.:
Zfish   295 FFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGW-IHHLAR 358

  Fly   439 S-----LTYDDLWNS 448
            .     ||..|||.|
Zfish   359 HAVACFLTRGDLWIS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phrNP_523653.2 phr2 93..547 CDD:129679 82/405 (20%)
DNA_photolyase 117..278 CDD:279247 37/196 (19%)
cry1aNP_001070765.2 PhrB 5..491 CDD:223492 82/405 (20%)
DNA_photolyase 5..167 CDD:279247 32/176 (18%)
FAD_binding_7 213..486 CDD:281440 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0415
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.