DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and YNR064C

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_014462.1 Gene:YNR064C / 855801 SGDID:S000005347 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:315 Identity:59/315 - (18%)
Similarity:113/315 - (35%) Gaps:70/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VGEADKIWTISMNTESKEVPLVLLHGLGAGIALWVMNLDAFAKGR-PVYAMDILGFGRSSRP--- 155
            |.:..|:|........... ::||||......:: .||.....|: .:.|.|:.|||.:..|   
Yeast    13 VQDGVKVWYREAGAAGNPT-ILLLHGFPTSSNMF-RNLIPLLAGQFHIIAPDLPGFGFTETPENY 75

  Fly   156 LFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPE 220
            .|:.|:| ||     |:......::|....:.....|..:....||..|.|:..::..:...:.|
Yeast    76 KFSFDSL-CE-----SIGYLLDTLSIEKFAMYIFDYGSPVGFRLALKFPSRITGIVTQNGNAYEE 134

  Fly   221 KPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQ-WVVQKTRPDIMRKFQSTIEEDINLL 284
            ...|.                      .|     ||..: |...::.|..::.....:|:..|::
Yeast   135 GLDDR----------------------FW-----GPLKEYWKSYQSDPVFVKSLIPYLEDPANVI 172

  Fly   285 PQY---IHQCNAQNPSGESAFHTMMQSFGWAK---------------HPMIHR-IKDVRSDIPIT 330
            .||   :....:.:|:..:....::|..|...               :|...: ::|  |.||:.
Yeast   173 CQYHDGVPAIESVDPAAYTLDIALIQRTGQTDIQLRLFFDYQNNIKLYPAFQKFLRD--SKIPVL 235

  Fly   331 FIYGSRSWIDSSSGEKIKSQRGSNMVDIKIV-TGAGH-----HVYADKPDVFNRY 379
            ..:|:...|.|.:|.:...:...|   :|:| ...||     ||.|...::.:.:
Yeast   236 VAWGANDTIFSVAGAEAYRKDVDN---LKVVYYDTGHFALETHVVAIAEEIISMF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 56/296 (19%)
Abhydrolase_5 114..>226 CDD:289465 27/115 (23%)
YNR064CNP_014462.1 Abhydrolase_1 30..275 CDD:395444 53/284 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.