DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and AT1G17430

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_564022.1 Gene:AT1G17430 / 838315 AraportID:AT1G17430 Length:332 Species:Arabidopsis thaliana


Alignment Length:367 Identity:74/367 - (20%)
Similarity:131/367 - (35%) Gaps:97/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FFLWKWLCNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAV-----GEADKIWTISMNTESK 111
            |.|::.|.:.....|.:::..:    |::.| |...|.|:.|..     ||....:.||.:....
plant    18 FTLFQRLISCFFDFPILIKIAD----SFLSL-YFLVFCDLRPVTVDLDDGETTVHFWISGHRRIS 77

  Fly   112 EVPLVLLHGLGAGIALW--VMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEE 174
            ...||:|||.| |.:.|  |..:...:|...::..|::.||:|           ..|...:|||.
plant    78 RQNLVMLHGYG-GNSKWQFVHQVSDLSKSFNLFIPDLVFFGKS-----------YSKNRDRSVEI 130

  Fly   175 WRREMNINDMILLG------------HSMGGFIASSYALSHPERVKHLILADPW-GFPEKPSDST 226
            ..|.: :..:..||            .|.|||:|...|...|..|:.|::.... ||.::.    
plant   131 QARSV-VGGLKKLGCVEGGGGISIYSISYGGFVAYKMAEIWPAMVEKLVIVSSGVGFTQQQ---- 190

  Fly   227 NGKTIPLWVRA--IARVLTPLNPL-------WALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDIN 282
              ||..|....  .:::|.|..|:       .::.....|..||     ||.             
plant   191 --KTAELKKHGGDCSKILVPKTPMDLRLLIKISMNTGLTFVDWV-----PDF------------- 235

  Fly   283 LLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDV--RSDIPITFIYGSRSWIDSSSGE 345
            .|.|:|.....:|                 :..::...|::  |.:.|...:...::.|.....:
plant   236 FLSQFIAVMYEKN-----------------RQELLELAKNLLEREEEPELPVISQKTLIVWGDKD 283

  Fly   346 KI-------KSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYV 380
            |:       :.||......::|:...||.|..:.|...|.::
plant   284 KVFPLEHAYRLQRHLQSSRLEIIKETGHAVNIEAPTTLNNFI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 60/300 (20%)
Abhydrolase_5 114..>226 CDD:289465 32/126 (25%)
AT1G17430NP_564022.1 MhpC 78..328 CDD:223669 60/302 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.