DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and AT5G09430

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_196505.2 Gene:AT5G09430 / 830802 AraportID:AT5G09430 Length:311 Species:Arabidopsis thaliana


Alignment Length:341 Identity:83/341 - (24%)
Similarity:125/341 - (36%) Gaps:69/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NWTSSSPTMLRAVEKKILSYVKLPYRGFFVDI--GPAVGE-ADKIWTISMNTESKEVPLVLLHGL 121
            ::|:|...:.|.      |:.....|....|:  |.::.. |...|.......||. .|:||||.
plant    12 SFTASRDWLFRQ------SFANAGLRSVTTDLSHGNSIASTAMHCWIPKSPNRSKP-NLLLLHGF 69

  Fly   122 GAGIALWVM--NLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDM 184
            ||. |:|..  :|.||.....||..|:|.||.||    ..:....|....:.:........:..|
plant    70 GAN-AMWQYGEHLRAFTGRFNVYVPDLLFFGLSS----TSEPNRTESFQARCLMRLMEAHGVQRM 129

  Fly   185 ILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGK-TIPLWVRAIARVLTPLNPL 248
            .::|.|.|||:..|.|...||.|:.|:|... |...:..|..:|. .:|....|.. :|.|..| 
plant   130 NIVGISYGGFVGYSLAAQFPENVEKLVLCCA-GVCLEEKDMEDGLFKVPNLEEATG-ILIPQTP- 191

  Fly   249 WALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESAF------HTMMQ 307
                          :|.:..|...|...|:                   |..:|      ..|..
plant   192 --------------EKLKELIRFSFVKPIK-------------------GVPSFFLWDFIDVMCT 223

  Fly   308 SFGWAKHPMIHRI-KDVR-SDIP-----ITFIYGSRSWI-DSSSGEKIKSQRGSNMVDIKIVTGA 364
            .|...|..:|..| ||.| ||:|     ...|:|....| ....|.::|...|.: .:|.::..|
plant   224 EFVEEKRDLIKSILKDRRLSDLPRIKQKSLIIWGEEDQIFPLELGYRLKRHIGES-AEIVVIKKA 287

  Fly   365 GHHVYADKPDVFNRYV 380
            ||.|..:|...|.:::
plant   288 GHAVNLEKSKEFVKHL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 72/284 (25%)
Abhydrolase_5 114..>226 CDD:289465 36/113 (32%)
AT5G09430NP_196505.2 MhpC 60..307 CDD:223669 73/287 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.