DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and AT4G39955

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_568075.1 Gene:AT4G39955 / 830156 AraportID:AT4G39955 Length:328 Species:Arabidopsis thaliana


Alignment Length:351 Identity:77/351 - (21%)
Similarity:141/351 - (40%) Gaps:65/351 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKEVPLVLLHGLGAGIALWVMN--LDAFAKGRP 140
            |:.:...|....|:|.  |.....|....:..:|.. |:||||:||. |:|..:  :|.|.....
plant    18 SFSRAGLRSSTSDLGD--GTVFHCWIPLTHIHTKPT-LLLLHGIGAN-AMWQWDRFIDRFIPRFN 78

  Fly   141 VYAMDILGFGRS--SRPLFAKD-ALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALS 202
            ||..|::.||.|  :||..::. ...|   .:|:::.:    .:..|.:.|.|.|||:|.|.|..
plant    79 VYVPDLIFFGDSYTTRPDRSESFQATC---VMKAMDAY----GVRTMTVAGLSYGGFVAYSLAAQ 136

  Fly   203 HPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRP 267
            ..|||..::|... |...:..||.:|         :.:|.:|..     .||..|.|      .|
plant   137 FKERVDRVVLICA-GVALEEKDSEDG---------MFKVKSPEE-----AAAVLFPQ------SP 180

  Fly   268 DIMRKFQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVR--SDIP-I 329
            .::|:.   ::......|.:|..|.|.:     ..|.|.:.:...:..::..:...|  :::| |
plant   181 SMLRRL---LQLSFYKPPIWIPSCFAMD-----YIHVMCKDYLQERKELVEALHKGRRFANLPKI 237

  Fly   330 T----FIYGSRSWI-DSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYV--------- 380
            |    .|:|....: ......::|...|.:...:.::...||.:..:||....:::         
plant   238 TQPTLMIWGEEDQVFPVELAHRLKRYLGEDRAQLVLLKKTGHAINEEKPKEMYKHMKSFLCTDAM 302

  Fly   381 ---NETCDMYKVAGGKLITPLQLIRE 403
               |...:..::....||:|.|.|.:
plant   303 IPQNHQINAKRLMLANLISPDQQINK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 64/292 (22%)
Abhydrolase_5 114..>226 CDD:289465 36/116 (31%)
AT4G39955NP_568075.1 MhpC 47..297 CDD:223669 65/287 (23%)
Abhydrolase_5 51..280 CDD:289465 61/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.