DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and AT4G36610

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_195379.1 Gene:AT4G36610 / 829813 AraportID:AT4G36610 Length:317 Species:Arabidopsis thaliana


Alignment Length:347 Identity:80/347 - (23%)
Similarity:134/347 - (38%) Gaps:85/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 MLRAVE-KKILSYVKLPYRG---FFVDIGPAVGEADKIW----TISMNT--------ESKEVPLV 116
            |:..|| :|.|.|..:...|   :.::|.|  |.....|    |:..|:        :..:.|:|
plant     1 MVNFVEVQKPLLYGLMKMAGVVPYTLEIEP--GTKINFWVPKETLKKNSGTGKPTKPDKPKKPVV 63

  Fly   117 LL-HGL-GAGIALWVMNLDAFAKGRPVYAMDILGFGRS------SRPLFAKDALVCEKQFVKSVE 173
            || ||. |.||..|...:.|.:|...||..|:|.||.|      ..|.|..|.||          
plant    64 LLIHGFAGEGIVTWQFQVGALSKKYSVYIPDLLFFGGSYTDNSDRSPAFQADCLV---------- 118

  Fly   174 EWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTI-PLWVRA 237
            :..|.:.::..:.:|.|.||.:|...|.::|:.|:.::::   |.....:|:.|..:: .|...:
plant   119 KGLRILGVDKFVPVGFSYGGMVAFKIAEAYPDMVRAIVVS---GSIPTMTDTINEASLNRLGFSS 180

  Fly   238 IARVLTP-----LNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCNAQNPS 297
            ...:|.|     |..|:.:....|.  |..::...|.:....:..:|...||...:         
plant   181 STDLLLPTSVTGLKALFTIAVHKPL--WFPKRLFKDYIEVMFNNRKERAELLEAVV--------- 234

  Fly   298 GESAFHTMMQSFGWAKHPMIHRIKDVRSDIP-----ITFIYGSRSWI-DSSSGEKIKSQRGSNMV 356
                                  :.:..:.||     |.|::|....| |......:|.|.|.| .
plant   235 ----------------------VSNKEAQIPHFPRKIHFLWGESDQIFDLELARDMKEQIGEN-A 276

  Fly   357 DIKIVTGAGHHVYADKPDVFNR 378
            .|:.:..|||.|..::|.|:||
plant   277 TIESIKKAGHLVQLERPCVYNR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 67/285 (24%)
Abhydrolase_5 114..>226 CDD:289465 35/119 (29%)
AT4G36610NP_195379.1 MhpC 62..307 CDD:223669 66/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.