DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and ABHD8

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_078803.4 Gene:ABHD8 / 79575 HGNCID:23759 Length:439 Species:Homo sapiens


Alignment Length:367 Identity:80/367 - (21%)
Similarity:126/367 - (34%) Gaps:117/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TISMNTESK---------EVPLVLLHGLGAGIALWVMNLDAFAK-GRPVYAMDILGFGRSSRP-- 155
            ||.::.|.:         :|.|..:||:|..:|:|...||.|.: |..|.|.|:.|.|.||.|  
Human   157 TIHIDCEKRITSCKGAQADVVLFFIHGVGGSLAIWKEQLDFFVRLGYEVVAPDLAGHGASSAPQV 221

  Fly   156 -------LFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILA 213
                   ..|:|.....|::.|     :|.      :|:|||.|....:..|..:|:.|..:|:.
Human   222 AAAYTFYALAEDMRAIFKRYAK-----KRN------VLIGHSYGVSFCTFLAHEYPDLVHKVIMI 275

  Fly   214 DPWGFPE--KPSDST--NGKTIPLWVRAIARVLTPLNP--LWALRAAGPFGQWVVQKTRPDIMRK 272
            :..| |.  :||..:  |..|.         ||..|:|  .|:...||...|...:|        
Human   276 NGGG-PTALEPSFCSIFNMPTC---------VLHCLSPCLAWSFLKAGFARQGAKEK-------- 322

  Fly   273 FQSTIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRS 337
                         |.:.:.||.|.| ......||....|   |....:......:|:..::|...
Human   323 -------------QLLKEGNAFNVS-SFVLRAMMSGQYW---PEGDEVYHAELTVPVLLVHGMHD 370

  Fly   338 WIDSSSGEKIKSQRGSNMVDI------KIVTGAGHHVYADKPDVFNRYVNETCDMYKVAGGKLIT 396
                   :.:..:....|.:|      |::....|.|..:.|:..|..::|.          |:.
Human   371 -------KFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETVNTLLHEF----------LLW 418

  Fly   397 PLQLIRESTESDEEREPSLSTAKTVEVQPEVQPVPQPVTAAD 438
                         |.|||          |:..|.|.|....|
Human   419 -------------EPEPS----------PKALPEPLPAPPED 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 65/289 (22%)
Abhydrolase_5 114..>226 CDD:289465 36/123 (29%)
ABHD8NP_078803.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..156
MhpC 156..416 CDD:223669 70/321 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.