DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Ppme1

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_082568.1 Gene:Ppme1 / 72590 MGIID:1919840 Length:386 Species:Mus musculus


Alignment Length:325 Identity:63/325 - (19%)
Similarity:109/325 - (33%) Gaps:110/325 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SSSPTMLRAVEKKILSYVKLPYRGFF-----VDIGPAVGEADKIWTISMNTESKEVP-LVLLHGL 121
            |.|...:|....:...:..:|:..:|     |::....|:.    |..:.....|.| |:||||.
Mouse    25 SQSGAKMRMGPGRKRDFTPVPWSQYFESMEDVEVENETGKD----TFRVYKSGSEGPVLLLLHGG 85

  Fly   122 GAGIALWVMNLDAFAKGRP--VYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNIND- 183
            |.....|.:...|......  :.|:|:.|.|.:.               ||:.|:...|....| 
Mouse    86 GHSALSWAVFTAAIISRVQCRIVALDLRGHGETK---------------VKNSEDLSAETMAKDV 135

  Fly   184 --------------MILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPS-------DSTN 227
                          ::|:||||||.||...|.:      :|:          ||       |...
Mouse   136 GNVVEAMYGDLPPPVMLIGHSMGGAIAVHTAAA------NLV----------PSLLGLCMIDVVE 184

  Fly   228 GKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCN 292
            |..:.                 ||.:...|     .:.||...:..::.||..:.          
Mouse   185 GTAMD-----------------ALNSMQNF-----LRGRPKTFKSLENAIEWSVK---------- 217

  Fly   293 AQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVD 357
                ||:      :::...|:..|:.::|....   ||...||:|.::....|:.:.:.||..|:
Mouse   218 ----SGQ------IRNLESARVSMVGQVKQCEG---ITSPEGSKSIVEGIIEEEEEDEEGSESVN 269

  Fly   358  357
            Mouse   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 54/269 (20%)
Abhydrolase_5 114..>226 CDD:289465 32/136 (24%)
Ppme1NP_082568.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 3/12 (25%)
MhpC 66..370 CDD:223669 56/280 (20%)
Abhydrolase_5 78..>195 CDD:289465 34/164 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..280 4/15 (27%)
SH3 270..>306 CDD:302595 63/325 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.