DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puml and Ephx3

DIOPT Version :9

Sequence 1:NP_001286169.1 Gene:puml / 35733 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001028335.1 Gene:Ephx3 / 71932 MGIID:1919182 Length:424 Species:Mus musculus


Alignment Length:298 Identity:57/298 - (19%)
Similarity:110/298 - (36%) Gaps:75/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PLVL-LHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRR 177
            ||:| |||.......|...|..|.....|.|:|:.|:..|..|              |.|:.:..
Mouse   162 PLMLFLHGFPENWFSWRYQLREFQSHFHVVAVDMRGYSPSDAP--------------KEVDCYTI 212

  Fly   178 EMNINDM------------ILLGHSMGGFIASSYALSHPERVKHLILAD--PWGFPEKPSDSTNG 228
            ::.::|:            ||:.|..|..:|..:::.:|..|:.:::|:  |....::.|     
Mouse   213 DLLLDDIKDTILGLGYSKCILVSHDWGASLAWEFSIYYPSLVERMVVANGPPMSVIQEYS----- 272

  Fly   229 KTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQSTIEEDINLLPQYIHQCN- 292
                  :..|.::... |.::..:.     .|:.:|...  |..||.       |...:.|:.| 
Mouse   273 ------IHHIGQIFRS-NYMFLFQL-----PWLPEKLLS--MSDFQI-------LKDTFTHRKNG 316

  Fly   293 --AQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPI---------TFIYGSRSWIDSSSGEK 346
              ...||...||.......|....| |:..::|..:.|:         ..::|.:   |.:..:.
Mouse   317 IPGLTPSELEAFLYHFSQPGCLTGP-INYYRNVFRNFPLEPKKLSTPTLLLWGEK---DFAFQQG 377

  Fly   347 IKSQRGSNMV----DIKIVTGAGHHVYADKPDVFNRYV 380
            :....|.:.|    :..|:.|:||.:....|...::|:
Mouse   378 LVEAIGRHFVPGRLESHILPGSGHWIPQSHPQEMHQYM 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pumlNP_001286169.1 MhpC 114..382 CDD:223669 57/298 (19%)
Abhydrolase_5 114..>226 CDD:289465 28/126 (22%)
Ephx3NP_001028335.1 Abhydrolase 139..>262 CDD:304388 26/113 (23%)
MhpC 144..415 CDD:223669 56/296 (19%)
Abhydrolase <341..424 CDD:304388 14/79 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.